DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and LOC797085

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001373298.1 Gene:LOC797085 / 797085 -ID:- Length:285 Species:Danio rerio


Alignment Length:237 Identity:73/237 - (30%)
Similarity:109/237 - (45%) Gaps:39/237 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IESYENYYNEIHIDDEQAEAKT-RNALTSPLQRWPGNKILYRISTDYS-----EQEVANVRTAMS 83
            ::|.|.|    .:::|....:| |||..   ..||...  ..:|..||     |.:..::..|:.
Zfish    76 VDSDEGY----ALEEEDIIPQTDRNAGN---HLWPEKD--GEVSVPYSIASGLEDKTGHILAALK 131

  Fly    84 SFGEQTCVQFEEIEGAPPAGKRYVSFKKSPNMCGTRV----GYQPLSFGPHEVVLNEKCLTMPAV 144
            ...::|||:|..    ....:.|:.||.. .||.:.|    |.||:..||       ||  ....
Zfish   132 MVSKKTCVKFHH----HTTEEDYLHFKPD-RMCASLVGCAGGEQPILVGP-------KC--NAGN 182

  Fly   145 IQHETLHLLGLFHEQSRPDRDEYVQIDYDNIPRKYWSQFMAMDQTTTFNVPYDYESVMHYSKNAF 209
            |.||.||.|||:||.||||||:|:.|.||||.....|.| .:.:..|..:.||.:|::||..:.|
Zfish   183 ICHEILHSLGLYHEHSRPDRDKYITILYDNIMPGKESNF-KVKKGNTLGLEYDLDSILHYGDDCF 246

  Fly   210 AKDPSKPTIRALIGGKAVEREMGQVRGPSEGDWTKIRLMYKC 251
            :::.:...|....|.|     :||....|..|..::|.:|.|
Zfish   247 SRNGNHTIIPKKKGVK-----IGQRTHMSVLDVERLRRLYHC 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 64/204 (31%)
ZnMc_astacin_like 59..249 CDD:239807 61/198 (31%)
LOC797085NP_001373298.1 ZnMc_astacin_like 111..281 CDD:239807 60/189 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.