DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and he1.3

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001091658.1 Gene:he1.3 / 792176 ZFINID:ZDB-GENE-040518-1 Length:271 Species:Danio rerio


Alignment Length:274 Identity:81/274 - (29%)
Similarity:122/274 - (44%) Gaps:52/274 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLAGIFAPNLVA-------SEGIESYENY-----------YNEIHIDDEQAEAKTRNALTSPLQ 55
            |||.||   :|.|       |.|||:.:|.           .:...|:.:....:|||||.....
Zfish    11 LLLVGI---SLAAPVGEYDNSNGIETPQNVDITTLLETNKGSSRRLIEGDMLYPQTRNALVCGNN 72

  Fly    56 R--WPGN-----KILYRISTDYSEQEVANVRTAMSSFGEQTCVQFEEIEGAPPAGKR-YVSFKKS 112
            .  |..|     ::.|.:|::||..|::.::.|||....:||::|     .|...:. |:|.:..
Zfish    73 NCFWKKNSSNFVEVPYIVSSEYSATEISVIQKAMSGIHNKTCIRF-----VPRISQTDYISIENQ 132

  Fly   113 PNMCGTRVGYQPLSFGPHEVVLNEKCLTMPAVIQHETLHLLGLFHEQSRPDRDEYVQIDYDNIPR 177
            .. |...:|   .:.|...|.|.:|.....:::|||..|.||.:||..|.|||.|:.|.::.|..
Zfish   133 DG-CFAFIG---KNGGKQLVSLRKKGCVYHSIVQHELNHALGFYHEHVRSDRDSYITIHWEYIAT 193

  Fly   178 KYWSQFMAMDQTTTFNVPYDYESVMHYSKNAFAKDPSKPTI-----RALIGGKAVEREMGQVRGP 237
            .....||..: |.:.|..|||.|:|||.|.||.....|.|:     ..:..|||  :||..:   
Zfish   194 NEIRNFMKKN-TNSQNTTYDYGSIMHYGKTAFTTVKGKETMTPYPDETVPIGKA--KEMSDI--- 252

  Fly   238 SEGDWTKIRLMYKC 251
               |..:|.:||.|
Zfish   253 ---DILRINMMYSC 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 62/208 (30%)
ZnMc_astacin_like 59..249 CDD:239807 59/200 (30%)
he1.3NP_001091658.1 ZnMc 82..263 CDD:294052 60/198 (30%)
Astacin 86..264 CDD:279708 61/196 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.