DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and TLL1

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_036596.3 Gene:TLL1 / 7092 HGNCID:11843 Length:1013 Species:Homo sapiens


Alignment Length:233 Identity:66/233 - (28%)
Similarity:110/233 - (47%) Gaps:12/233 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GIESYENYYNEIHIDDEQAEAKTR--NALTSPLQR-WPGNKILYRISTDYSEQEVANVRTAMSSF 85
            |:|.......::.:.......|.|  .|.||..:| |||..|.|.|..:::..:.|..:.||..:
Human   121 GLEQNNTVKGKVPLQFSGQNEKNRVPRAATSRTERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHW 185

  Fly    86 GEQTCVQFEEIEGAPPAGKRYVSFKKSPNMCGTRVGYQPLSFGPHEVVLNEKCLTMPAVIQHETL 150
            .:.|||.|.|....    :.|:.|...|..|.:.||.:  ..||..:.:.:.|... .::.||..
Human   186 EKHTCVTFIERSDE----ESYIVFTYRPCGCCSYVGRR--GNGPQAISIGKNCDKF-GIVVHELG 243

  Fly   151 HLLGLFHEQSRPDRDEYVQIDYDNIPRKYWSQFMAMD--QTTTFNVPYDYESVMHYSKNAFAKDP 213
            |::|.:||.:|||||.:|.|..:||.......|:.|:  :..:....||::|:|||::|.|::..
Human   244 HVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIMHYARNTFSRGM 308

  Fly   214 SKPTIRALIGGKAVEREMGQVRGPSEGDWTKIRLMYKC 251
            ...||........:...:||....|:||..:.|.:|:|
Human   309 FLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRC 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 58/198 (29%)
ZnMc_astacin_like 59..249 CDD:239807 54/191 (28%)
TLL1NP_036596.3 ZnMc_BMP1_TLD 148..347 CDD:239808 62/206 (30%)
Astacin 155..348 CDD:279708 59/199 (30%)
CUB 349..458 CDD:278839
CUB 462..571 CDD:278839
FXa_inhibition 582..614 CDD:291342
CUB 618..727 CDD:278839
FXa_inhibition 734..769 CDD:291342
CUB 774..883 CDD:278839
CUB 887..1000 CDD:278839
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.