DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and astl2c

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001037864.1 Gene:astl2c / 594901 XenbaseID:XB-GENE-6449741 Length:496 Species:Xenopus tropicalis


Alignment Length:249 Identity:78/249 - (31%)
Similarity:114/249 - (45%) Gaps:36/249 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IFAPNLVASEGIESYENYYNEIHIDDEQAEAKTRNALTSPLQRWP--GNKIL---YRISTDYSEQ 73
            :|...|.|::|..::       |:..:.|...:|:|:......||  .|.|:   |.||:|||:.
 Frog    43 VFGRILRANKGKRNF-------HVQGDIAHKFSRSAINCKECLWPKDSNGIVNVPYTISSDYSQN 100

  Fly    74 EVANVRTAMSSFGEQTCVQFEEIEGAPPAGK-RYVSFKKSPNMCGTRVGYQPLSFGPHEVVLNEK 137
            |.:.:..||..|...|||||     .|...: .|::.:.... |.:.:|   ::.|..:|.|.:.
 Frog   101 EASLIMAAMQEFATLTCVQF-----IPQTDEDDYIAIQPLDG-CWSYIG---VNGGAQQVSLGKG 156

  Fly   138 CLTMPAVIQHETLHLLGLFHEQSRPDRDEYVQIDY-----DNIPRKYWSQFMAMDQTTTFNVPYD 197
            ......|||||..|:||..||.||.|||.||.|:|     |||      .|.....|....:.||
 Frog   157 GCIYYGVIQHELNHVLGFVHEHSRSDRDNYVHINYQYISPDNI------AFFDKKDTDNLGLEYD 215

  Fly   198 YESVMHYSKNAFAKDPSKPTIRALIGGKAVEREMGQVRGPSEGDWTKIRLMYKC 251
            |.|||||...:::....|.||..:.....   .:||..|.|..|.:||..:|:|
 Frog   216 YSSVMHYPGYSYSNTTGKNTIVPIPNANV---PIGQRYGLSTLDVSKINRLYQC 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 69/206 (33%)
ZnMc_astacin_like 59..249 CDD:239807 66/198 (33%)
astl2cNP_001037864.1 ZnMc_hatching_enzyme 84..266 CDD:239810 67/199 (34%)
Astacin 89..266 CDD:279708 65/194 (34%)
CUB 270..380 CDD:238001
CUB 383..495 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.