DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and CG34370

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001097404.2 Gene:CG34370 / 5740565 FlyBaseID:FBgn0085399 Length:952 Species:Drosophila melanogaster


Alignment Length:140 Identity:33/140 - (23%)
Similarity:49/140 - (35%) Gaps:31/140 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 ISTDYSEQEVANVRTAMSSFGEQ-TC-VQFEEIEGAPPAGKRYVSFKKSP-----NMCGTRVGYQ 123
            |..|.|..||:|     .:.|.. || .:|..::|||......:.|||..     |......||.
  Fly    84 IFEDISSPEVSN-----QNVGRPLTCWYRFRTLKGAPRDFVLRLRFKKFKVGQLLNATHCEGGYL 143

  Fly   124 PLSFGPHEVVLNEK------C--LTMPAVIQHETLHLLGLFHE-----------QSRPDRDEYVQ 169
            .:..|..:..::.:      |  ...|.....||.::..|||.           .||.::...|.
  Fly   144 QIVDGNAKTDVSNRREPGMFCGEAEQPQTFISETSYVKVLFHTDNFTDQTYFTFDSRAEQQTEVY 208

  Fly   170 IDYDNIPRKY 179
            :.|...|..|
  Fly   209 LRYGQHPELY 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 33/140 (24%)
ZnMc_astacin_like 59..249 CDD:239807 33/140 (24%)
CG34370NP_001097404.2 CUB 88..195 CDD:238001 25/111 (23%)
CUB 244..363 CDD:238001
CUB 407..509 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444878
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.