DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and he1.1

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001038639.1 Gene:he1.1 / 569018 ZFINID:ZDB-GENE-021211-3 Length:263 Species:Danio rerio


Alignment Length:228 Identity:72/228 - (31%)
Similarity:111/228 - (48%) Gaps:23/228 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NEIHIDDEQAEAKTRNALTSPLQR--WPGN-----KILYRISTDYSEQEVANVRTAMSSFGEQTC 90
            :|:..:.:....|.|||.....:.  |..|     ::.|.:|.::|..:.:.:..|:|.|..|||
Zfish    50 SEVLFEGDVVLPKNRNAFICEDKSCFWKKNANNIVEVPYVVSGEFSINDKSVIANAISIFHAQTC 114

  Fly    91 VQF--EEIEGAPPAGKRYVSFKKSPNMCGTRVGYQPLSFGPHEVVLNEKCLTMPAVIQHETLHLL 153
            ::|  ..|:.      .|:|.:.... |.:.:|   .:.|...|.||.|......:.|||..|.|
Zfish   115 IRFVPRSIQA------DYLSIENKDG-CYSAIG---RTGGKQVVSLNRKGCVYSGIAQHELNHAL 169

  Fly   154 GLFHEQSRPDRDEYVQIDYDNIPRKYWSQFMAMDQTTTFNVPYDYESVMHYSKNAFAKDPSKPTI 218
            |.:|||||.|||:||:|:::||.......|: ..:|...|.||||.|:|||.|.|||..|...||
Zfish   170 GFYHEQSRSDRDQYVRINWNNISPGMAYNFL-KQKTNNQNTPYDYGSLMHYGKTAFAIQPGLETI 233

  Fly   219 RALIGGKAVEREMGQVRGPSEGDWTKIRLMYKC 251
            ..:.....   ::||.:|.|:.|..:|..:|.|
Zfish   234 TPIPDENV---QIGQRQGLSKIDILRINKLYGC 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 66/204 (32%)
ZnMc_astacin_like 59..249 CDD:239807 64/196 (33%)
he1.1NP_001038639.1 ZnMc_hatching_enzyme 81..263 CDD:239810 64/195 (33%)
Astacin 86..263 CDD:279708 64/190 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.