DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and hce2l1

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_009302797.1 Gene:hce2l1 / 564183 ZFINID:ZDB-GENE-070912-147 Length:232 Species:Danio rerio


Alignment Length:227 Identity:70/227 - (30%)
Similarity:96/227 - (42%) Gaps:48/227 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 TRNALT--SPLQRWPGN-----KILYRISTDYSEQEVANVRTAMSSFGEQTCVQFEEIEGAPPAG 103
            :|:|:|  ....|||..     .:.|.:||.|.:.:...:.|.|......|||:|      .|..
Zfish    29 SRSAITCLGDSCRWPKAVDGFVYVPYIMSTLYDDMDRITIETGMLDISSSTCVKF------VPRT 87

  Fly   104 KRYVSFKKSPNM-CGTRVGYQPLSFGPHEVVLNEKCLTMPAVIQHETLHLLGLFHEQSRPDRDEY 167
            .:.......|.. |.:.:|   ::.|...|.|.........|..||.:|.||..|||||.|||.|
Zfish    88 HQANFLNIQPRYGCWSYLG---MTGGSQTVSLQSPGCMWSGVASHELMHALGFVHEQSRSDRDRY 149

  Fly   168 VQIDYDNIP-------RKYWSQFMAMDQTTTFNVPYDYESVMHYSKNAFAKDPSKPTIRALIGGK 225
            |.|.::||.       |||        :|...|..|||.|||||.:.||::|          ||.
Zfish   150 VSILWENIIENQRHNFRKY--------ETNNLNTAYDYSSVMHYGRYAFSED----------GGP 196

  Fly   226 AVERE------MGQVRGPSEGDWTKIRLMYKC 251
            .:..:      :||..|||..|..||.::|.|
Zfish   197 TIIPKPDPYIPIGQRDGPSILDIHKINILYNC 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 66/214 (31%)
ZnMc_astacin_like 59..249 CDD:239807 62/208 (30%)
hce2l1XP_009302797.1 Astacin 41..229 CDD:279708 67/215 (31%)
ZnMc_hatching_enzyme 47..228 CDD:239810 63/207 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.