DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and cuzd1.2

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_021323075.1 Gene:cuzd1.2 / 555768 ZFINID:ZDB-GENE-131119-30 Length:718 Species:Danio rerio


Alignment Length:256 Identity:55/256 - (21%)
Similarity:85/256 - (33%) Gaps:74/256 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FLKAVRYLLL------AGI-------FAPNLVASEG-------------IESYENYY----NEIH 36
            |....|||.:      :|:       |..:|.|.:|             ..||.|..    |:::
Zfish   411 FHSTSRYLTVVFRSDFSGVSHGFKAHFTSSLTADQGRVDCSSDNMVIVLRRSYLNSLGFSGNDLY 475

  Fly    37 IDDEQAEAKTRNALTSPLQRWPGN-----KILYRISTDYSEQEVANVRTAMSSFG---------- 86
            :||........:  |..:.|:|.|     |.:......|:.    |||.:.|..|          
Zfish   476 VDDRLCRPNISS--TEVVFRFPLNTCGTAKKMMNSFVSYTN----NVRASPSQSGVITRQSEFLL 534

  Fly    87 -------EQTCVQF----EEIEGAPPAGKRYVSFKKSPNMCGTRVGYQPLSFGPHEVVLNEKCLT 140
                   ..|.||.    |||......|..  .|..|.....:|...|.:...|:||.||:....
Zfish   535 SVGCRMEPDTIVQIFYKAEEIPNGNITGTG--RFNASIAFYTSRKFNQQIYDSPYEVYLNDDLFV 597

  Fly   141 MPAVIQHETLHLLGLFHEQ--SRPDRDEYVQIDYD----NIPR--KYWSQFMAMDQTTTFN 193
            ...:.:.:.  .|.||.|.  :.|:.:::....||    ..||  .:.|....:||...|:
Zfish   598 QVKLTRFDA--SLDLFLETCVASPNPNDFKDYSYDLLRNGCPRDSTFQSYINGVDQYAQFS 656

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 39/173 (23%)
ZnMc_astacin_like 59..249 CDD:239807 37/169 (22%)
cuzd1.2XP_021323075.1 CUB 21..127 CDD:238001
Somatomedin_B 131..164 CDD:307259
Somatomedin_B 175..214 CDD:321959
Somatomedin_B <239..260 CDD:307259
CUB 330..439 CDD:238001 6/27 (22%)
ZP 450..694 CDD:214579 46/217 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.