DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and tll2l

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001016661.1 Gene:tll2l / 549415 XenbaseID:XB-GENE-478930 Length:500 Species:Xenopus tropicalis


Alignment Length:246 Identity:74/246 - (30%)
Similarity:118/246 - (47%) Gaps:26/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 AGIFAPNLVASEGIESYENYYNEIHIDDEQAEAKTRNALTSPLQRWPGNK-----ILYRISTDYS 71
            |.||...:.::|||:       ::.:..:.|....|::|.....:|..:.     :.:.:|..|:
 Frog    43 ADIFTQIIASNEGID-------QLLLQGDIAIRVVRSSLQCDNCKWDISSNGKVPVPFTVSPGYT 100

  Fly    72 EQEVANVRTAMSSFGEQTCVQFEEIEGAPPAGKRYVSFKKSPNMCGTRVGYQPLSFGPHEVVLNE 136
            :.::|.:..||..|...|||.|     .|...::.|....:.|.|.:.:|   .|.|..:|.|::
 Frog   101 KSQLALITAAMQEFETLTCVDF-----VPKTNEKNVININNGNGCWSYIG---RSGGVQQVSLSK 157

  Fly   137 KCLTMPAVIQHETLHLLGLFHEQSRPDRDEYVQIDYDNI-PRKYWSQFMAMDQTTTFNVPYDYES 200
            :...:..:||||..|:||..||..|.|||:||.:...|| |....:..:|:  |....:||||.|
 Frog   158 QSCMVKGIIQHELNHVLGFVHEHVRSDRDQYVNVVKKNILPDSLGNFDIAV--TNNLGLPYDYYS 220

  Fly   201 VMHYSKNAFAKDPSKPTIRALIGGKAVEREMGQVRGPSEGDWTKIRLMYKC 251
            ||||.:|||:..|..||   ||.......::||..|.:..|..||..:|.|
 Frog   221 VMHYPRNAFSISPFLPT---LITKPDPTIQIGQRYGLTNLDIAKINKLYNC 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 64/201 (32%)
ZnMc_astacin_like 59..249 CDD:239807 62/195 (32%)
tll2lNP_001016661.1 ZnMc_hatching_enzyme 86..268 CDD:239810 63/194 (32%)
CUB 272..382 CDD:238001
CUB 385..495 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.