DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and c6ast3

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001013544.1 Gene:c6ast3 / 541399 ZFINID:ZDB-GENE-050320-99 Length:255 Species:Danio rerio


Alignment Length:275 Identity:81/275 - (29%)
Similarity:130/275 - (47%) Gaps:44/275 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFLKAVRYLLLAGIFAPNLVASEGIESYENYYNEIH---------------IDDEQAEAKTRNAL 50
            ||:..|.:.|||.:|   :.::||..:..:....:|               :||.....|..:..
Zfish     1 MFVTKVTFGLLALMF---VYSAEGKPAQLSVSELLHRANRGIIPEADEPKLLDDIAVNEKNADPC 62

  Fly    51 TSPLQRWP---GNKIL--YRISTDYSEQEVANVRTAMSSFGEQTCVQFEEIEGAPPAGKR-YVSF 109
            ||....||   ..||.  |.|:..||.:|:..::..:.||...||::|     .|...:| |:|.
Zfish    63 TSYGCLWPKYSDGKIYVPYVIANHYSSRELEIIQRGLDSFSYSTCIRF-----FPRGNERDYISI 122

  Fly   110 KKSPNMCGTRVGYQPLSFGPHEVVLNEKCLTMPAVIQHETLHLLGLFHEQSRPDRDEYVQIDYDN 174
             :|.:.|.:.||.|  .:.....:....|| ..:.:|||.||.||..|||:|.|||.::|:.::|
Zfish   123 -ESRSGCYSYVGRQ--GYAQTVSLARSGCL-YHSTVQHELLHALGFNHEQTRNDRDNHIQVIWEN 183

  Fly   175 I--PRKY-WSQFMAMDQTTTFNVPYDYESVMHYSKNAFAKDPSKPTIRALIGGKAVEREMGQVRG 236
            |  ..|| :::...::|.|    ||||.|||.|.:.||:|: ..||:..:....|.   :|....
Zfish   184 ILDDMKYNFNKVNTLNQGT----PYDYSSVMQYERYAFSKN-GLPTMIPIPNNNAA---LGTSTE 240

  Fly   237 PSEGDWTKIRLMYKC 251
            .|:.|..:|..:|:|
Zfish   241 MSQNDIIRINRLYQC 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 65/204 (32%)
ZnMc_astacin_like 59..249 CDD:239807 62/195 (32%)
c6ast3NP_001013544.1 Astacin 68..255 CDD:279708 65/203 (32%)
ZnMc 74..255 CDD:294052 63/197 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.