DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and ASTL

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_011509507.1 Gene:ASTL / 431705 HGNCID:31704 Length:436 Species:Homo sapiens


Alignment Length:215 Identity:62/215 - (28%)
Similarity:101/215 - (46%) Gaps:33/215 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LTSPLQRWP--GNKIL---YRISTDYSEQEVANVRTAMSSFGEQTCVQF-------EEIEGAPPA 102
            |::...:||  |:.::   :.:|:.|.|.....:..|::.|...||::|       :.|...|..
Human    92 LSATSNKWPMGGSGVVEVPFLLSSKYDEPSRQVILEALAEFERSTCIRFVTYQDQRDFISIIPMY 156

  Fly   103 GKRYVSFKKSPNMCGTRVGYQPLSFGPHEVVLNEKCLTM-PAVIQHETLHLLGLFHEQSRPDRDE 166
            |            |.:.||   .|.|...|.|...||.. ..::.||.:|:||.:||.:|.|||.
Human   157 G------------CFSSVG---RSGGMQVVSLAPTCLQKGRGIVLHELMHVLGFWHEHTRADRDR 206

  Fly   167 YVQIDYDNIPRKYWSQFMAMDQTTTFNVPYDYESVMHYSKNAFAKDPSKPTIRALIGGKAVEREM 231
            |::::::.|...:...|: ..|::....||||.|||||.:.||:: ...|||..|   .|....:
Human   207 YIRVNWNEILPGFEINFI-KSQSSNMLTPYDYSSVMHYGRLAFSR-RGLPTITPL---WAPSVHI 266

  Fly   232 GQVRGPSEGDWTKIRLMYKC 251
            ||....|..|.|::..:|.|
Human   267 GQRWNLSASDITRVLKLYGC 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 60/208 (29%)
ZnMc_astacin_like 59..249 CDD:239807 57/200 (29%)
ASTLXP_011509507.1 Astacin 97..288 CDD:279708 61/210 (29%)
ZnMc 105..286 CDD:294052 57/200 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.