DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and tok

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001287510.1 Gene:tok / 42944 FlyBaseID:FBgn0004885 Length:1464 Species:Drosophila melanogaster


Alignment Length:217 Identity:64/217 - (29%)
Similarity:109/217 - (50%) Gaps:8/217 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DDEQAEAKTRNALTSPLQR-WPGNKILYRISTDYSEQEVANVRTAMSSFGEQTCVQFEEIEGAPP 101
            |:|....:...|:|:..:| |....|.|.|..::|....|..:.||..:...||::|  :|..|.
  Fly   509 DEEPLRHRVARAVTAKKERIWDYGVIPYEIDGNFSGIHKALFKLAMRHWENSTCIKF--VERDPE 571

  Fly   102 AGKRYVSFKKSPNMCGTRVGYQPLSFGPHEVVLNEKCLTMPAVIQHETLHLLGLFHEQSRPDRDE 166
            ....|:.|......|.:.||.:  ..||..:.:...|... .::.||..|::|.:||.:||||::
  Fly   572 IHPNYIVFTVRSCGCCSFVGKR--GNGPQAISIGRNCDKF-GIVVHELGHVVGFWHEHTRPDREK 633

  Fly   167 YVQIDYDNIPR--KYWSQFMAMDQTTTFNVPYDYESVMHYSKNAFAKDPSKPTIRALIGGKAVER 229
            :|.|:::||.:  .|....::.|:..:..:.|||:|:|||::|.|:|.....||..:........
  Fly   634 HVVIEHNNIMKGQDYNFNMLSPDEVDSLGMAYDYDSIMHYARNTFSKGTYLDTILPIEMKGRKRP 698

  Fly   230 EMGQVRGPSEGDWTKIRLMYKC 251
            |:||....|:||..:..|:|||
  Fly   699 EIGQRLRLSQGDIAQANLLYKC 720

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 58/198 (29%)
ZnMc_astacin_like 59..249 CDD:239807 55/191 (29%)
tokNP_001287510.1 ZnMc_BMP1_TLD 520..721 CDD:239808 62/206 (30%)
Astacin 527..721 CDD:279708 60/199 (30%)
CUB 723..836 CDD:294042
CUB 840..951 CDD:278839
FXa_inhibition 958..993 CDD:291342
CUB 997..1111 CDD:278839
FXa_inhibition 1118..1153 CDD:291342
CUB 1158..1267 CDD:278839
CUB 1271..1390 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444863
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.