DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and CG6763

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster


Alignment Length:212 Identity:74/212 - (34%)
Similarity:112/212 - (52%) Gaps:11/212 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 QAEAKTRNALTSPLQRWPGNKILYRISTDYSEQEVANVRTAMSSFGEQTCVQFEEIEGAPPAGKR 105
            |.:...:|.|.:...|||...:.|.|..:::.:::|.:..|:..:..:||::|.:    ..:.:.
  Fly   101 QTDLIMKNGLPTQSSRWPNGVVPYEIRGNFNARDMATIENAIGEYHRRTCIRFVK----RSSERD 161

  Fly   106 YVSFKKSPNMCGTRVGYQPLSFGPHEVVLNEK-CLTMPAVIQHETLHLLGLFHEQSRPDRDEYVQ 169
            |:|.:...:.|.:.||...   |..||.|... ||:.|....||.:|.||..|||:|.:||.||.
  Fly   162 YISIRGDNSGCWSSVGRVG---GKQEVNLQSPGCLSRPGTAMHELMHALGFLHEQNRMERDGYVA 223

  Fly   170 IDYDNIPRKYWSQFMAMDQTTTFNVPYDYESVMHYSKNAFAKDPSKPTIRALIGGKAVEREMGQV 234
            |.|:|:.....:.|....:|..|.|||||.||||||||||:.: .:|||.|:....|  .:|||.
  Fly   224 IQYNNVQSSAMNNFEKAARTEAFGVPYDYGSVMHYSKNAFSIN-GQPTILAMQANGA--DKMGQR 285

  Fly   235 RGPSEGDWTKIRLMYKC 251
            .|.|:.|..|:..||.|
  Fly   286 NGFSDYDIQKLNRMYDC 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 70/196 (36%)
ZnMc_astacin_like 59..249 CDD:239807 65/190 (34%)
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 71/197 (36%)
ZnMc_astacin_like 119..300 CDD:239807 65/190 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444946
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D122071at6656
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.