DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and Nrx-1

DIOPT Version :10

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001262840.1 Gene:Nrx-1 / 42646 FlyBaseID:FBgn0038975 Length:1847 Species:Drosophila melanogaster


Alignment Length:99 Identity:20/99 - (20%)
Similarity:35/99 - (35%) Gaps:40/99 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 EIEGAPPAGKRYVSFKKSPNMCGTRVGYQPLSFGPHEVVLNEKCLTMPAVIQHETLHLLGLFHEQ 159
            :::||||.                            ..:|:|..|...:.::..::||.||||  
  Fly   885 QVDGAPPV----------------------------RGMLSETILGRHSTMEIRSVHLGGLFH-- 919

  Fly   160 SRPDRDEYVQIDYDNIPRKYWSQFMAMDQTTTFN 193
                .:|.:|:. ..:|     .|:...|...||
  Fly   920 ----AEEEIQMT-STMP-----NFVGQMQGLVFN 943

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 ZnMc_astacin_like 59..249 CDD:239807 20/99 (20%)
Nrx-1NP_001262840.1 LamG 110..263 CDD:238058
EGF_CA 311..347 CDD:238011
Laminin_G_2 386..517 CDD:460494
LamG 555..716 CDD:238058
EGF 746..777 CDD:394967
Laminin_G_2 814..945 CDD:460494 20/99 (20%)
Laminin_G_2 1010..1138 CDD:460494
Laminin_G_2 1233..1356 CDD:460494
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.