DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and MEP1B

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_005916.2 Gene:MEP1B / 4225 HGNCID:7020 Length:701 Species:Homo sapiens


Alignment Length:269 Identity:88/269 - (32%)
Similarity:134/269 - (49%) Gaps:41/269 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFLKAVRYLLLAGIFAP-NLVASEGIE----------SYENYYNEIHIDDEQAEAKTRNALTSPL 54
            :||.|:  |:::|:..| |.....|::          ..:.:..:|.:|    .|:.||::....
Human    10 LFLDAL--LVISGLATPENFDVDGGMDQDIFDINEGLGLDLFEGDIRLD----RAQIRNSIIGEK 68

  Fly    55 QRWPGNKILYRISTDYSEQEVANVRTAMSSFGEQTCVQFEEIEGAPPAGK-RYVS-FKKS---PN 114
            .||| :.|.|.:...........:..|...:..:||:.|:     |.||: .|:| ||.|   .:
Human    69 YRWP-HTIPYVLEDSLEMNAKGVILNAFERYRLKTCIDFK-----PWAGETNYISVFKGSGCWSS 127

  Fly   115 MCGTRVGYQPLSFGPHEVVLNEKCLTMPAVIQHETLHLLGLFHEQSRPDRDEYVQIDYDNI--PR 177
            :...|||.|.||.|.:       |..: |.:|||.||.||.:|||||.|||:||:|.:|.|  .|
Human   128 VGNRRVGKQELSIGAN-------CDRI-ATVQHEFLHALGFWHEQSRSDRDDYVRIMWDRILSGR 184

  Fly   178 KYWSQFMAMDQTTTFNVPYDYESVMHYSKNAFAKDPSKPTIRALIGGKAVEREMGQVRGPSEGDW 242
            ::.....:.|.:.:.||||||.|||||||.|| ::.::|||...|..  .|..:||....|:.|.
Human   185 EHNFNTYSDDISDSLNVPYDYTSVMHYSKTAF-QNGTEPTIVTRISD--FEDVIGQRMDFSDSDL 246

  Fly   243 TKIRLMYKC 251
            .|:..:|.|
Human   247 LKLNQLYNC 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 74/202 (37%)
ZnMc_astacin_like 59..249 CDD:239807 70/196 (36%)
MEP1BNP_005916.2 ZnMc_meprin 26..255 CDD:239809 81/249 (33%)
Astacin 69..257 CDD:279708 75/204 (37%)
MAM 260..427 CDD:214533
MAM 265..427 CDD:99706
MATH 427..586 CDD:295307
Required for proteolytic processing 595..607
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.