DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and MEP1A

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_011512930.1 Gene:MEP1A / 4224 HGNCID:7015 Length:774 Species:Homo sapiens


Alignment Length:211 Identity:74/211 - (35%)
Similarity:102/211 - (48%) Gaps:18/211 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KTRNALTSPLQRW--PGNKILYRISTDYSEQEVANVRTAMSSFGEQTCVQFEEIEGAPPAGKRYV 107
            |:||.|..|..||  |   |.|.::.:........:..|...|..::||.|:..||.    ..|:
Human    91 KSRNGLRDPNTRWTFP---IPYILADNLGLNAKGAILYAFEMFRLKSCVDFKPYEGE----SSYI 148

  Fly   108 SFKKSPNMCGTRVGYQPLSFGPHEVVLNEKCLTMPAVIQHETLHLLGLFHEQSRPDRDEYVQIDY 172
            .|::... |.:.||.|.:.   ..:.:.:.| ...|:|:||.||.||.:|||||.|||:||.|.:
Human   149 IFQQFDG-CWSEVGDQHVG---QNISIGQGC-AYKAIIEHEILHALGFYHEQSRTDRDDYVNIWW 208

  Fly   173 DNIPRKYWSQFMAMDQT--TTFNVPYDYESVMHYSKNAFAKDPSKPTIRALIGGKAVEREMGQVR 235
            |.|...|...|...|.:  |..|.||||||:|||...:|.|:.|.|||.|.|  ......:||..
Human   209 DQILSGYQHNFDTYDDSLITDLNTPYDYESLMHYQPFSFNKNASVPTITAKI--PEFNSIIGQRL 271

  Fly   236 GPSEGDWTKIRLMYKC 251
            ..|..|..::..||.|
Human   272 DFSAIDLERLNRMYNC 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 68/199 (34%)
ZnMc_astacin_like 59..249 CDD:239807 63/191 (33%)
MEP1AXP_011512930.1 ZnMc_meprin 58..287 CDD:239809 73/209 (35%)
Astacin 101..289 CDD:279708 69/201 (34%)
MAM 292..459 CDD:214533
MAM 297..459 CDD:99706
MATH_Meprin_Alpha 459..622 CDD:239752
EGF_CA 700..738 CDD:238011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6774
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.