Sequence 1: | NP_650414.1 | Gene: | CG6974 / 41815 | FlyBaseID: | FBgn0038285 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_524034.2 | Gene: | Nrx-IV / 39387 | FlyBaseID: | FBgn0013997 | Length: | 1284 | Species: | Drosophila melanogaster |
Alignment Length: | 330 | Identity: | 57/330 - (17%) |
---|---|---|---|
Similarity: | 105/330 - (31%) | Gaps: | 116/330 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 KAVRYLLLAGIFAPNLVASEGIES-----YENYYNEIHIDDEQAEAKTRNALTSPLQRWP----- 58
Fly 59 -GNKILYRISTDYSE------------QEVANV-RTAMSSFGEQTCVQFEEIEGAPPAGKRYVSF 109
Fly 110 KKSPNMCGTRVGYQPLSFGPHEVVLNEKCLTMPAVIQHETLHLLGLFHEQSRPDRDEYVQIDYDN 174
Fly 175 IPRKYWSQFMAMDQTTTFN----VPYDY---------ESVMHYSKNAFA---------------- 210
Fly 211 ---KDPSKPTIRALIGGK------------------------------AVEREMGQVRGPSEGDW 242
Fly 243 TKIRL 247 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6974 | NP_650414.1 | Astacin | 55..251 | CDD:279708 | 45/274 (16%) |
ZnMc_astacin_like | 59..249 | CDD:239807 | 43/264 (16%) | ||
Nrx-IV | NP_524034.2 | FA58C | 46..185 | CDD:214572 | 23/152 (15%) |
FA58C | 57..184 | CDD:238014 | 22/140 (16%) | ||
LamG | 192..340 | CDD:238058 | 23/120 (19%) | ||
LamG | 376..514 | CDD:238058 | |||
EGF | 546..575 | CDD:278437 | |||
Laminin_G_2 | 824..943 | CDD:280389 | |||
EGF_CA | 966..998 | CDD:238011 | |||
Laminin_G_2 | 1032..1156 | CDD:280389 | |||
4.1m | 1239..1255 | CDD:128590 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45444949 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |