DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and Nrx-IV

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_524034.2 Gene:Nrx-IV / 39387 FlyBaseID:FBgn0013997 Length:1284 Species:Drosophila melanogaster


Alignment Length:330 Identity:57/330 - (17%)
Similarity:105/330 - (31%) Gaps:116/330 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KAVRYLLLAGIFAPNLVASEGIES-----YENYYNEIHIDDEQAEAKTRNALTSPLQRWP----- 58
            ||....|..|:....|:.:.||:|     :.:|:::...:....|.....|.:|..:|.|     
  Fly     9 KAAFSSLQFGLLCLLLLVNNGIKSVQADAFTDYFSDYDCNQPLMERAVLTATSSLTERGPDKARL 73

  Fly    59 -GNKILYRISTDYSE------------QEVANV-RTAMSSFGEQTCVQFEEIEGAPPAGKRYVSF 109
             ||.....:...|:.            :::|.: |.....|..:..||:.: :|  ...:.||:.
  Fly    74 NGNAAWTPVENTYNHFLTLDLGDPRMVRKIATMGRMHTDEFVTEYIVQYSD-DG--EFWRSYVNP 135

  Fly   110 KKSPNMCGTRVGYQPLSFGPHEVVLNEKCLTMPAVIQHETLHLLGLFHEQSRPDRDEYVQIDYDN 174
            ...|.|.........:.:...||.:..:.:.:.....|:.:.:           |.|....||  
  Fly   136 TSEPQMFKGNSDGNSIHYNVFEVPIIAQWVRINPTRWHDRISM-----------RVELYGCDY-- 187

  Fly   175 IPRKYWSQFMAMDQTTTFN----VPYDY---------ESVMHYSKNAFA---------------- 210
                       :.:...||    |.||.         ||:....|.|||                
  Fly   188 -----------ISENLYFNGTGLVRYDLRREPITSTKESIRFRFKTAFANGVMMYSRGTQGDYYA 241

  Fly   211 ---KDPSKPTIRALIGGK------------------------------AVEREMGQVRGPSEGDW 242
               || :|..:...:|.:                              :|:|.:  |||..:|::
  Fly   242 LQLKD-NKMVLNLDLGSRVMTSLSVGSLLDDNVWHDVVISRNQRDIIFSVDRVI--VRGRIQGEF 303

  Fly   243 TKIRL 247
            |::.|
  Fly   304 TRLNL 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 45/274 (16%)
ZnMc_astacin_like 59..249 CDD:239807 43/264 (16%)
Nrx-IVNP_524034.2 FA58C 46..185 CDD:214572 23/152 (15%)
FA58C 57..184 CDD:238014 22/140 (16%)
LamG 192..340 CDD:238058 23/120 (19%)
LamG 376..514 CDD:238058
EGF 546..575 CDD:278437
Laminin_G_2 824..943 CDD:280389
EGF_CA 966..998 CDD:238011
Laminin_G_2 1032..1156 CDD:280389
4.1m 1239..1255 CDD:128590
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444949
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.