DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and Cubn2

DIOPT Version :10

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_729748.3 Gene:Cubn2 / 39334 FlyBaseID:FBgn0259140 Length:3613 Species:Drosophila melanogaster


Alignment Length:268 Identity:56/268 - (20%)
Similarity:93/268 - (34%) Gaps:62/268 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GIESYENYYNEIHIDDEQAEAKTRNALTSPLQRWPGNKILYRI-------STDYSEQEVANVRTA 81
            |.||......|..:   :...:.|....|||.||  .::.|::       ||.::.:...|..: 
  Fly  2989 GEESIGRLCPEFEV---KGNGRVRLRYVSPLSRW--FEMQYQLIQCGGNYSTSFTLRPPQNEDS- 3047

  Fly    82 MSSFGEQTCVQFEEIEGAPPAGKRYVSFKKSPNMCGTRVGYQPLSFGPHEVVLNEK-----C--L 139
             |.:...|..::...  |||.....:.||..........|:..|:.....||..|:     |  :
  Fly  3048 -SVYAHNTLCEWRIT--APPQHAVVIEFKYFDMESSRNCGFDSLTIYRGHVVSEEQRTGLLCGNV 3109

  Fly   140 TMPAVI---QHETLHLLGLFHEQS----------RPDRDEYVQIDYDNIPRKYWSQFMAMDQTTT 191
            |.|..|   .:|.|.:|......|          .|:.:|:|.:|.: :||      |::.:...
  Fly  3110 TNPETIIVNSNEALIVLTTDSSNSYRGFLASVRFTPNCNEHVALDLE-VPR------MSVMRQYV 3167

  Fly   192 FNV------------PYDYESVMHYSKNAFAKDPSKPTIRAL-------IGGKAVEREMGQVRGP 237
            .|:            |.||...:...|...|.|....|...|       :.|:.:.|..|...|.
  Fly  3168 VNISESLLCIFQASAPPDYRISLEVRKLQLADDVVCRTCSYLEIHDSKDVEGQNLGRYYGGTNGN 3232

  Fly   238 SEGDWTKI 245
            ...:.||:
  Fly  3233 EPSNRTKV 3240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 ZnMc_astacin_like 59..249 CDD:239807 46/233 (20%)
Cubn2NP_729748.3 cubilin_NTD 38..141 CDD:412063
EGF_CA 156..190 CDD:238011
EGF_CA 192..233 CDD:238011
EGF_CA 290..328 CDD:214542
EGF_CA 330..374 CDD:214542
EGF 427..455 CDD:394967
EGF_CA 462..496 CDD:238011
CUB 503..619 CDD:238001
CUB 624..738 CDD:238001
CUB 745..854 CDD:238001
CUB 857..963 CDD:238001
CUB 1066..1179 CDD:238001
CUB 1185..1293 CDD:238001
CUB 1303..1406 CDD:238001
CUB 1411..1523 CDD:238001
CUB 1530..1648 CDD:238001
CUB 1754..1862 CDD:238001
CUB 1979..2091 CDD:238001
CUB 2210..2321 CDD:238001
CUB 2327..2441 CDD:238001
CUB 2688..2782 CDD:412131
CUB 2810..2911 CDD:238001
CUB 3029..3143 CDD:238001 23/117 (20%)
CUB 3169..3249 CDD:412131 15/72 (21%)
CUB 3499..3607 CDD:238001
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.