DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and nas-23

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001022281.1 Gene:nas-23 / 3565992 WormBaseID:WBGene00003542 Length:537 Species:Caenorhabditis elegans


Alignment Length:272 Identity:75/272 - (27%)
Similarity:113/272 - (41%) Gaps:50/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 AGIFAPNLVASEGIESYEN---------YYNEIHID------------DEQAEAKT--RNALTSP 53
            ||:..|....::.:.|..:         :..:||:.            |.....:|  |||: .|
 Worm    57 AGVSLPKHEYTDRLSSISDLNRSKRDLLFQGDIHLSFEHLSNIVREQLDHSRTKRTAFRNAM-YP 120

  Fly    54 LQRWPGNKILYRISTDYSEQEVANVRTAMSSFGEQTCVQFEEIEGAPPAGKRYVSFKKSPNMCGT 118
            ...|..| :.:.:....|.:..:::..||:.:.:.|||.|::    ..:.|.|:........|.:
 Worm   121 KTIWLPN-VPFELHGSLSAKSRSSLVAAMAFWEKHTCVAFKK----RTSEKVYLLMSGQEEGCWS 180

  Fly   119 RVGYQPLSFGPHEVVLNEKCLTMPAVIQHETLHLLGLFHEQSRPDRDEYVQIDYDNIPRKYWSQF 183
            .||..... |...:.:...| .|..:..||..|.|||||||||.|||.||||....|.:..:..|
 Worm   181 TVGRDEAQ-GAQILNIGTGC-EMFGITSHEIAHALGLFHEQSRYDRDNYVQIVKSRIAQTNFYDF 243

  Fly   184 MAMDQTT--TFNVPYDYESVMHYSKNAFAKDPSKPTIRALIGGKAV-------EREMGQVRGPSE 239
            ..:.:..  |:...||..|||||          :||..:|.||.::       :..|||.||||.
 Worm   244 AVVGKKNMETYGQKYDIGSVMHY----------RPTEFSLDGGNSIIAKDVNMQNTMGQFRGPSF 298

  Fly   240 GDWTKIRLMYKC 251
            .|..||...|.|
 Worm   299 IDVAKINRHYNC 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 62/204 (30%)
ZnMc_astacin_like 59..249 CDD:239807 60/198 (30%)
nas-23NP_001022281.1 Astacin 122..310 CDD:279708 62/204 (30%)
ZnMc_astacin_like 128..308 CDD:239807 59/195 (30%)
CUB 384..454 CDD:294042
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14369
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.