DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and CG7631

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster


Alignment Length:260 Identity:80/260 - (30%)
Similarity:122/260 - (46%) Gaps:41/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLAGIF-APNLVASEGIESYENYYNEI-------HIDDEQAEAKTRNALTSPLQRWPGNKILYRI 66
            |.:||| ||          :..:|:|.       :...:......||...|..:|||...:.|||
  Fly    14 LCSGIFPAP----------FNTHYDETDPELTAGYFQGDMDVDYARNGQLSETRRWPNATVPYRI 68

  Fly    67 STDYSEQEVANVRTAMSSFGEQTCVQF---EEIEGAPPAGKRYVSFKKSPNMCGTRVGYQPLSFG 128
            |.::....|..::..|......:|::|   :|.|      :.|:....|.:.|.::|||||   |
  Fly    69 SEEFDAPHVEYIKLGMQFIEYSSCIRFVPADEDE------ENYLFVLPSTSGCSSKVGYQP---G 124

  Fly   129 PHEV-----VLNEKCLTMPAVIQHETLHLLGLFHEQSRPDRDEYVQIDYDNIPRKYWSQFMAM-- 186
            ...|     .|:..|..: ..||||.||.||..|:|..|:|||:|:|..:||...:...|:..  
  Fly   125 ERTVKLKPGSLDTGCFKL-GTIQHELLHTLGFHHQQCSPNRDEFVKIVEENISEGHEKNFVKYEE 188

  Fly   187 DQTTTFNVPYDYESVMHYSKNAFAKDPSKPTIRALIGGKAVEREMGQVRGPSEGDWTKIRLMYKC 251
            |:...|:.||||.|::|||..||:.: .:.||.||  ....:.:|||....|:.|..::..||||
  Fly   189 DEVGDFDQPYDYGSILHYSSLAFSIN-GEATIVAL--NPEGQEQMGQRLMMSDTDVKRLNTMYKC 250

  Fly   252  251
              Fly   251  250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 67/205 (33%)
ZnMc_astacin_like 59..249 CDD:239807 62/199 (31%)
CG7631NP_609760.1 Astacin 57..251 CDD:279708 69/207 (33%)
ZnMc_astacin_like 61..248 CDD:239807 62/199 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444913
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D122071at6656
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.