DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and CG15253

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster


Alignment Length:219 Identity:74/219 - (33%)
Similarity:106/219 - (48%) Gaps:15/219 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DEQAEAKTRNALTSPLQRWPGNKILYRISTDYSEQEVANVRTAMSSFGEQTCVQFEEIEGAPPAG 103
            |......:||...:...|||...|.|.|::...|:...::.:|:......:|:.|:|   |....
  Fly    39 DMVPSGSSRNIWRNETYRWPNRIIYYHINSYIDEEHRNHIVSAIQKIESISCLTFKE---ATTDQ 100

  Fly   104 KRYVSFKKSPNMCGTRVGY----QPLSFGPHEVVLNEKCLTMPAVIQHETLHLLGLFHEQSRPDR 164
            |.||:.......|.:.:||    |.|:...:|:.:.  |..:..:: ||.||.||.||:||..||
  Fly   101 KYYVNVTSEEGGCFSYIGYLNRVQQLNLQNNEIGVG--CFRLYTIV-HEFLHALGFFHQQSAADR 162

  Fly   165 DEYVQIDYDNIPRKYWSQFMAMDQTTT--FNVPYDYESVMHYSKNAFAKDPSKPTIRALIGGKAV 227
            |:||||..:||.......|....:.|.  |...|||.|||||...||:|:..: ||.||..||  
  Fly   163 DDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSKNGER-TILALEEGK-- 224

  Fly   228 EREMGQVRGPSEGDWTKIRLMYKC 251
            |..:||....||.|..|:..:|||
  Fly   225 EDVIGQRLELSETDIRKLNAIYKC 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 69/201 (34%)
ZnMc_astacin_like 59..249 CDD:239807 65/195 (33%)
CG15253NP_609758.1 Astacin 55..250 CDD:279708 71/203 (35%)
ZnMc_astacin_like 59..246 CDD:239807 65/195 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444936
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D122071at6656
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.