DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and mep1bb

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_009294699.1 Gene:mep1bb / 327586 ZFINID:ZDB-GENE-030131-5797 Length:774 Species:Danio rerio


Alignment Length:235 Identity:78/235 - (33%)
Similarity:109/235 - (46%) Gaps:31/235 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GIESYENYYNEIHIDDEQAEAKTRNALTSPLQRWPGNKILYRISTDYSEQEVANVRTAMSSFGEQ 88
            |::.:|   .:|..|    |...||::.....||| ..|.|....|........:..|...:..:
Zfish    57 GLDLFE---GDILYD----ETLGRNSIIGEEYRWP-KTIPYYFEDDLEINAKGVILKAFEQYRLK 113

  Fly    89 TCVQFEEIEGAPPAGKRYVSFKKSPNMC-----GTRVGYQPLSFGPHEVVLNEKCLTMPAVIQHE 148
            ||:.::...|.    :.|:|..|. |.|     ..|||.|.||.|       ..|..: |.|:||
Zfish   114 TCIDYKPWTGE----ENYISVFKG-NGCFSSVGNRRVGRQTLSIG-------SGCDRI-ATIEHE 165

  Fly   149 TLHLLGLFHEQSRPDRDEYVQIDYDNIPRKYWSQFMAMDQTTT--FNVPYDYESVMHYSKNAFAK 211
            .||.||.:|||||.|||:||.|.:|.|.......|...:.:::  .||||||.|:||||:.|| :
Zfish   166 FLHALGFWHEQSRSDRDDYVSIMWDRITEGKEHNFNKYNDSSSSALNVPYDYSSMMHYSQKAF-Q 229

  Fly   212 DPSKPTIRALIGGKAVEREMGQVRGPSEGDWTKIRLMYKC 251
            ..|:|||...|  .|....:||....|:.|..|:..:|.|
Zfish   230 SGSEPTIITRI--PAFSSVIGQRMEFSDSDLLKLNRLYNC 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 70/202 (35%)
ZnMc_astacin_like 59..249 CDD:239807 66/196 (34%)
mep1bbXP_009294699.1 ZnMc 39..267 CDD:294052 77/233 (33%)
Astacin 81..269 CDD:279708 71/204 (35%)
MAM 277..441 CDD:279023
MAM 277..440 CDD:99706
MATH 440..608 CDD:295307
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.