DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and Mep1b

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_037315.1 Gene:Mep1b / 25727 RGDID:3081 Length:704 Species:Rattus norvegicus


Alignment Length:261 Identity:85/261 - (32%)
Similarity:126/261 - (48%) Gaps:24/261 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FLKAVRYLLLAGIFAPNLVASE---GIESYENYYNE-IHID----DEQAEAKTRNALTSPLQRWP 58
            ||....:||::|:.||.....:   ||:......|| :.:|    |.:.||..||::.....|||
  Rat     9 FLVFATFLLVSGLPAPEKFVKDIDGGIDQDIFDINEDLGLDLFEGDIKLEASGRNSIIGDNYRWP 73

  Fly    59 GNKILYRISTDYSEQEVANVRTAMSSFGEQTCVQFEEIEGAPPAGKRYVS-FKKSPNMCGTRVGY 122
             :.|.|.:...........:..|...:..:||:.|:...|.    :.|:| ||.|.  |.:.|| 
  Rat    74 -HTIPYVLEDSLEMNAKGVILNAFERYRLKTCIDFKPWSGE----ENYISVFKGSG--CWSSVG- 130

  Fly   123 QPLSFGPHEVVLNEKCLTMPAVIQHETLHLLGLFHEQSRPDRDEYVQIDYDNIPRKYWSQFMAMD 187
             .:..|..|:.:...|..: |.:|||.||.||.:|||||.|||:|:.|.:|.|.......|...:
  Rat   131 -NIHAGKQELSIGTNCDRI-ATVQHEFLHALGFWHEQSRADRDDYITIVWDRILSGKEHNFNIYN 193

  Fly   188 QTT--TFNVPYDYESVMHYSKNAFAKDPSKPTIRALIGGKAVEREMGQVRGPSEGDWTKIRLMYK 250
            .:.  :.||||||.|||||||.|| ::.::.||...|..  .|..:||....|:.|..|:..:|.
  Rat   194 DSVSDSLNVPYDYTSVMHYSKTAF-QNGTESTIITKISD--FEDVIGQRMDFSDYDLLKLNQLYS 255

  Fly   251 C 251
            |
  Rat   256 C 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 67/198 (34%)
ZnMc_astacin_like 59..249 CDD:239807 63/192 (33%)
Mep1bNP_037315.1 ZnMc 30..256 CDD:294052 77/238 (32%)
Astacin 70..258 CDD:279708 68/200 (34%)
MAM 266..430 CDD:279023
MAM 266..428 CDD:99706
MATH 428..586 CDD:295307
EGF_CA 609..647 CDD:238011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.