DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and Mep1a

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_037275.1 Gene:Mep1a / 25684 RGDID:3080 Length:748 Species:Rattus norvegicus


Alignment Length:209 Identity:74/209 - (35%)
Similarity:101/209 - (48%) Gaps:14/209 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KTRNALTSPLQRWPGNKILYRISTDYSEQEVANVRTAMSSFGEQTCVQFEEIEGAPPAGKRYVSF 109
            :|||||..|..||. ..|.|.::.:........:..|...|..::||.|:..||.    ..|:.|
  Rat    64 RTRNALRDPSSRWK-PPIPYILADNLDLNAKGAILNAFEMFRLKSCVDFKPYEGE----SSYIIF 123

  Fly   110 KKSPNMCGTRVGYQPLSFGPHEVVLNEKCLTMPAVIQHETLHLLGLFHEQSRPDRDEYVQIDYDN 174
            ::... |.:.||.|.:.   ..:.:.|.| ...|:|:||.||.||.||||||.|||:||.|.::.
  Rat   124 QQFSG-CWSMVGDQHVG---QNISIGEGC-DYKAIIEHEILHALGFFHEQSRTDRDDYVNIWWNE 183

  Fly   175 IPRKYWSQFMAMDQ--TTTFNVPYDYESVMHYSKNAFAKDPSKPTIRALIGGKAVEREMGQVRGP 237
            |...|...|...|.  .|..|.||||||:|||...:|.|:.:.|||...|  ......:||....
  Rat   184 IMTDYEHNFNTYDDKTITDLNTPYDYESLMHYGPFSFNKNETIPTITTKI--PEFNAIIGQRLDF 246

  Fly   238 SEGDWTKIRLMYKC 251
            |..|.|::..||.|
  Rat   247 SATDLTRLNRMYNC 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 67/197 (34%)
ZnMc_astacin_like 59..249 CDD:239807 63/191 (33%)
Mep1aNP_037275.1 ZnMc 32..260 CDD:294052 73/207 (35%)
Astacin 75..261 CDD:279708 68/198 (34%)
MAM 270..433 CDD:279023
MAM 270..432 CDD:99706
MATH 432..596 CDD:295307
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 641..668
EGF 676..710 CDD:278437
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.