DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and Astl

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001277932.1 Gene:Astl / 215095 MGIID:3046414 Length:435 Species:Mus musculus


Alignment Length:243 Identity:68/243 - (27%)
Similarity:106/243 - (43%) Gaps:33/243 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SEGIESYENYYNEIHIDDEQAEAKTRNALTSPLQRWPGN-----KILYRISTDYSEQEVANVRTA 81
            ::|:.|.|...:...::.:.........|:....:||..     :|.:.:|..|.|.....:..|
Mouse    59 NQGLISEETPESSFLVEGDIIRPSPFRLLSVTNNKWPKGVGGFVEIPFLLSRKYDELSRRVIMDA 123

  Fly    82 MSSFGEQTCVQFEEIEG-------APPAGKRYVSFKKSPNMCGTRVGYQPLSFGPHEVVLNEKCL 139
            .:.|...||::|....|       .|.||            |.:.||   .|.|...|.|...||
Mouse   124 FAEFERFTCIRFVAYHGQRDFVSILPMAG------------CFSGVG---RSGGMQVVSLAPTCL 173

  Fly   140 TM-PAVIQHETLHLLGLFHEQSRPDRDEYVQIDYDNIPRKYWSQFMAMDQTTTFNVPYDYESVMH 203
            .. ..::.||.:|:||.:||.||.|||.|:|::::.|...:...|: ..::|...|||||.||||
Mouse   174 RKGRGIVLHELMHVLGFWHEHSRADRDRYIQVNWNEILPGFEINFI-KSRSTNMLVPYDYSSVMH 237

  Fly   204 YSKNAFAKDPSKPTIRALIGGKAVEREMGQVRGPSEGDWTKIRLMYKC 251
            |.:.||:. ..:|||..|.....   .:||....|..|.|::..:|.|
Mouse   238 YGRFAFSW-RGQPTIIPLWTSSV---HIGQRWNLSTSDITRVCRLYNC 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 63/208 (30%)
ZnMc_astacin_like 59..249 CDD:239807 60/202 (30%)
AstlNP_001277932.1 Astacin 92..282 CDD:279708 64/210 (30%)
ZnMc 100..281 CDD:294052 61/200 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..356
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.