DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and nas-30

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_490795.5 Gene:nas-30 / 190803 WormBaseID:WBGene00003548 Length:741 Species:Caenorhabditis elegans


Alignment Length:182 Identity:58/182 - (31%)
Similarity:87/182 - (47%) Gaps:25/182 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KTRNALTSPLQRWPGNKILYRISTDYSEQEVANVRTAMSSFGEQTCVQFEEIEGAPPAGKRYVSF 109
            |.|..:|..:.||. :.|.:|.....::.:.. :|..:..:.::|||::.  |..|  ||.||.|
 Worm   321 KKRKVITGSVYRWK-SVIPFRFKGGDAKWKKL-IREGLGLWEKETCVRWS--ENGP--GKDYVIF 379

  Fly   110 KKSPNMCGTRVGYQPLSFGPHEVVLNEKCLTMPAVIQHETLHLLGLFHEQSRPDRDEYVQIDYD- 173
            .:... |.:.||   .:.|...:.:...| ....::.||..|.||.:|||||||||:|:.:..| 
 Worm   380 FRGSG-CYSSVG---RTGGSQLISIGYGC-EDKGIVAHEVGHSLGFWHEQSRPDRDDYIHLRKDW 439

  Fly   174 -------NIPRKYWSQFMAMDQTTTFNVPYDYESVMHYSKNAFAKDPSKPTI 218
                   |..::.|.:...|      .||||..|||||..|||.||..:.||
 Worm   440 IIKGTDGNFEKRSWEEIEDM------GVPYDVGSVMHYGSNAFTKDWDQITI 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 55/172 (32%)
ZnMc_astacin_like 59..249 CDD:239807 53/168 (32%)
nas-30NP_490795.5 ZnMc_astacin_like 336..514 CDD:239807 53/166 (32%)
CUB 564..648 CDD:412131
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14369
orthoMCL 1 0.900 - - OOG6_111101
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6486
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.