DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and nas-27

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_493926.2 Gene:nas-27 / 188809 WormBaseID:WBGene00003545 Length:428 Species:Caenorhabditis elegans


Alignment Length:266 Identity:72/266 - (27%)
Similarity:109/266 - (40%) Gaps:45/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IFAPNLVAS-----EGIESYEN----------------YYNEIHIDDEQAEAKTRNALTSPLQRW 57
            ||.|.|:.|     .|..:..|                |..:|.:...:|.   |..:....::|
 Worm     6 IFFPLLITSLHAIPRGRRAVRNRNEGDINSLVGVGQYLYQGDIAVVKSRAR---RAVIRQKHKKW 67

  Fly    58 --PGNKILYRISTDYSEQEVANVRTAMSSFGEQTCVQFEEIEGAPPAGKRYVSFKKS---PNMCG 117
              |   :.|....::..:....|..||..:.|:|||.|.|        .|||....|   .|.|.
 Worm    68 KLP---MPYSFDRNFPSRSRQRVLEAMQFWSEKTCVTFHE--------NRYVYPHVSIFEGNGCW 121

  Fly   118 TRVGYQPLSFGPHEVVLNEKCLTMPAVIQHETLHLLGLFHEQSRPDRDEYVQIDYDNIPRKYWSQ 182
            :.||.|| |.....:.|...|.....|:.||..|.||.:||.:|.|||:::.|||.|:.......
 Worm   122 SFVGKQP-SLREQSLSLERSCTDHTFVVAHEIAHTLGFYHEHARGDRDQFISIDYSNVNPNLTFA 185

  Fly   183 FM--AMDQTTTFNVPYDYESVMHYSKNAFAKDPSKPTIRALIGGKAVEREMGQVRGPSEGDWTKI 245
            |.  :..|.......|:|.||||||.:.||.:.::|.|.|  ..:...:.||.....:..|.:::
 Worm   186 FAKESEKQLDHQEAAYEYGSVMHYSVDQFAVNTNRPVIYA--RDQKFAQAMGNRMRATFQDVSRM 248

  Fly   246 RLMYKC 251
            .::|.|
 Worm   249 NVLYNC 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 60/202 (30%)
ZnMc_astacin_like 59..249 CDD:239807 57/194 (29%)
nas-27NP_493926.2 Astacin 65..254 CDD:279708 60/202 (30%)
ZnMc_astacin_like 70..252 CDD:239807 58/195 (30%)
CUB 334..410 CDD:294042
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14369
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.