DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and nas-21

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_505907.2 Gene:nas-21 / 188422 WormBaseID:WBGene00003540 Length:380 Species:Caenorhabditis elegans


Alignment Length:228 Identity:68/228 - (29%)
Similarity:94/228 - (41%) Gaps:44/228 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DDEQAEAKTRNALTSPLQ-RWPGNKILYRISTD-YSEQEVANVRTAMSSFGEQTCVQFEEIEGAP 100
            :.::.|...|.||....: |||...|.|..... :.|...|.|..||......||::|     :|
 Worm    36 ETKRLERSKRQALRMDNEPRWPRGTINYFFDEQRFDENSRATVLRAMEKISNHTCIKF-----SP 95

  Fly   101 PAGK---RYVSFKKSPNMCGTRVG--YQPLSFGPHEVVLNEKCLTMPAVIQHETLHLLGLFHEQS 160
            ...:   |.||.|......| |||  .|.|||       ...|.::.:.  .|.:|::|..|...
 Worm    96 KDARIKLRIVSDKGCQAAIG-RVGGDQQYLSF-------PTSCYSVGSA--SELIHVIGFLHSHQ 150

  Fly   161 RPDRDEYVQIDYDNIPRKYWSQFMA----MDQTTTFNVPYDYESVMHY--SKNAFAKDPSKPTIR 219
            |.|||||::::........|.|.|.    :||  .:.|||||.|:|.|  |.|.:....||    
 Worm   151 RADRDEYLKLNLQPWRLNDWFQTMQYKKYLDQ--WWIVPYDYGSIMQYHDSDNEYGPKNSK---- 209

  Fly   220 ALIGGKAVEREMG-QVRGPSEGDWTKIRLMYKC 251
                   ..|.|| |:  ||..|:..|...|:|
 Worm   210 -------YFRTMGSQI--PSYFDYLMINEYYQC 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 63/209 (30%)
ZnMc_astacin_like 59..249 CDD:239807 59/202 (29%)
nas-21NP_505907.2 ZnMc 52..192 CDD:214576 47/156 (30%)
ZnMc_astacin_like 59..231 CDD:239807 59/201 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.