DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and nas-3

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_505445.2 Gene:nas-3 / 187045 WormBaseID:WBGene00003522 Length:292 Species:Caenorhabditis elegans


Alignment Length:282 Identity:69/282 - (24%)
Similarity:111/282 - (39%) Gaps:73/282 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RYLLLAGIFAPNLVASEGIESYENYYNEIHI-------------DDEQA----EAKTRNALTSPL 54
            |:::...:.|  |.||:..|..::  :||.:             ||:.|    ..|.|.....|.
 Worm     3 RFIIFFSLLA--LTASKVSEPEKD--DEIAVKIPTKRSVSEPPKDDDIAVKIPMRKKRGIAIHPW 63

  Fly    55 Q----RWPGNKILYRISTDYSEQEVANVRTAMSSFGEQTCVQFEEIEGAPPAGKRYVSFKKSPNM 115
            |    .||..::.|.|::.|:..|...:.:||.:|.:.|||:|.....   ..|.|:...|...:
 Worm    64 QWESHLWPNAEVPYDIASHYTATERGIILSAMEAFRDVTCVRFRPRRS---TDKHYLQINKHYQL 125

  Fly   116 --CGTRVGYQPLS--FGPHE------VVLNEKCLTM--PAVIQHETLHLLGLFHEQSRPDRDEYV 168
              |.:.:|.|...  ||..:      :.|:..||..  ...:.||.:|:||.:||..|.|||..:
 Worm   126 ERCFSYIGRQSSRWLFGTRDGKVETRMKLDPSCLLYNGRGTVMHELMHILGFYHEHQRDDRDRRI 190

  Fly   169 ---QIDYD-NIPRKYWSQFMAMDQTTTFNVPYDYESVMHYSKNAFAKDPSKPTIRALIGGKAVER 229
               ...|: .|.::..|.:|.         .||..|:|||:   |...|.:            :|
 Worm   191 GGSASHYNFKIYQRAKSYYMG---------GYDANSIMHYN---FGSVPWQ------------KR 231

  Fly   230 EMGQVRGPSEGDWTKIRLMYKC 251
            :..     |..|...|..:|||
 Worm   232 DYF-----SPSDIRNINTLYKC 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 53/215 (25%)
ZnMc_astacin_like 59..249 CDD:239807 49/205 (24%)
nas-3NP_505445.2 Astacin 69..250 CDD:279708 54/212 (25%)
ZnMc 72..246 CDD:294052 49/205 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.