DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and nas-33

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_509086.2 Gene:nas-33 / 186987 WormBaseID:WBGene00003551 Length:644 Species:Caenorhabditis elegans


Alignment Length:185 Identity:58/185 - (31%)
Similarity:89/185 - (48%) Gaps:34/185 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 WPGNKILYR-ISTDYSEQEVANVRTAMSSFGEQTCVQFEEIEGAPPAGKRYVSFKKSPNMCGTRV 120
            |..| |.|| :.||.:.|  :.:...:..:...||::| .:.|   .|..|:.|.|... |.:.|
 Worm   202 WSRN-IPYRFLDTDGNWQ--SQITNGLRHYERNTCIRF-SLNG---GGSDYLVFSKGEG-CYSSV 258

  Fly   121 GYQPLSFGPHEVVLNEKCLTMPAVIQHETLHLLGLFHEQSRPDRDEYVQIDYDN--------IPR 177
            |...   ||.|:.:.:.|.|: .:|.||..|.||.:|||:||:||.||:|:..|        ..:
 Worm   259 GRLG---GPQEISIGDGCETL-GIITHEVGHALGFWHEQARPERDSYVRINRQNAINGLEGQFDK 319

  Fly   178 KYWSQFMAMDQTTTFNVPYDYESVMHYSKNAFAK-------DPSKPTIRALIGGK 225
            :.||      :...:::||||.|||||...:|:|       :|..|.....||.:
 Worm   320 RSWS------EVNEYSLPYDYGSVMHYGPKSFSKSSTMNTVEPVDPAFINTIGNR 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 58/185 (31%)
ZnMc_astacin_like 59..249 CDD:239807 57/183 (31%)
nas-33NP_509086.2 Astacin 200..386 CDD:279708 58/185 (31%)
ZnMc_astacin_like 203..381 CDD:239807 57/184 (31%)
CUB 442..527 CDD:294042
TSP1 553..595 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6774
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14369
orthoMCL 1 0.900 - - OOG6_111101
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6486
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.