DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and nas-17

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_505892.1 Gene:nas-17 / 186923 WormBaseID:WBGene00003536 Length:448 Species:Caenorhabditis elegans


Alignment Length:209 Identity:57/209 - (27%)
Similarity:94/209 - (44%) Gaps:19/209 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KTRNALTSPLQRWPGNKILYRISTDYSEQEVANVRTAMSSFGEQTCVQFEEIEGAPPAGKRYVSF 109
            :::..:|...::||..|:.|....:::..:...:..||:.....|||:|:|...|... .|:.:.
 Worm    78 RSKRQITKIWKKWPDAKVFYYYENEFTSLKRELMSYAMAHISSNTCVKFQESNSATNR-IRFTNT 141

  Fly   110 KKSPNMCGTRVGYQPLSFGPHEVVLNEKCLTMPAVIQHETLHLLGLFHEQSRPDRDEYVQIDYDN 174
            ....:..|...|.|.|.||       :.||.....: ||.:|.|||||..||.|||.::.:.|.:
 Worm   142 GGCASYIGMNGGEQTLWFG-------DGCLIFGTAV-HEIMHSLGLFHTHSRFDRDNFLSVSYKD 198

  Fly   175 IPRKYWSQFMAMDQTTTFN-VPYDYESVMHYSKNAFAKDPSKPTIRALIG-GKAVEREMGQVRGP 237
            :|...........:.||:| ||::|.|.|.|..|.|.:.       .|:. .:..::.|| :|..
 Worm   199 VPENMVGNLEKETEQTTYNAVPFEYGSTMLYRYNTFGEG-------TLVSKNEDYQKTMG-LRRV 255

  Fly   238 SEGDWTKIRLMYKC 251
            |..|...|.:.|.|
 Worm   256 SFYDLVNINVRYSC 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 55/197 (28%)
ZnMc_astacin_like 59..249 CDD:239807 52/191 (27%)
nas-17NP_505892.1 Astacin 88..271 CDD:279708 56/199 (28%)
ZnMc_astacin_like 92..267 CDD:239807 52/191 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.