DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and nas-29

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_494953.3 Gene:nas-29 / 186488 WormBaseID:WBGene00003547 Length:532 Species:Caenorhabditis elegans


Alignment Length:221 Identity:66/221 - (29%)
Similarity:100/221 - (45%) Gaps:16/221 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IDDEQAEAKTRNALTS---PLQRWPGNKILYRISTDYSEQEVANVRTAMSSFGEQTCVQFEEIEG 98
            |:.|..:...|.|...   |...|. |.:.:......:......:..|:..:..:||::|.    
 Worm   124 INGESTDRTKRQAYLDNNYPATIWK-NGVAFMFHESLTPIAKTAILKAVHFWYRETCIEFH---- 183

  Fly    99 APPA-GKRYVSFKKSPNMCGTRVGYQPLSFGPHEVVLNEKCLTMPAVIQHETLHLLGLFHEQSRP 162
             |.. .|.|:.|..:.:.|.:.|| :..|.|...|.:...|... .|..||..|.||:||||||.
 Worm   184 -PRTFQKEYLLFIGNDDGCWSTVG-RDASQGKQVVSIGNGCEHF-GVTSHELAHALGIFHEQSRF 245

  Fly   163 DRDEYVQIDYDNIPRKYWSQFMAMD--QTTTFNVPYDYESVMHYSKNAFAKDPSKPTIRALIGGK 225
            ||||.|..:...:.|.....|..:.  |.:|:.:|||..|||||:...|:..||.||:.|:  ..
 Worm   246 DRDESVVFNPRVVERDLLFNFAKISPRQMSTYGLPYDIGSVMHYTPTEFSNIPSIPTLAAI--DT 308

  Fly   226 AVEREMGQVRGPSEGDWTKIRLMYKC 251
            .:::.|||:.|||..|...:...|:|
 Worm   309 NLQQTMGQLEGPSFVDVHIMNQHYQC 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 60/198 (30%)
ZnMc_astacin_like 59..249 CDD:239807 58/192 (30%)
nas-29NP_494953.3 Astacin 145..336 CDD:279708 61/200 (31%)
ZnMc_astacin_like 148..332 CDD:239807 58/193 (30%)
CUB 404..491 CDD:214483
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14369
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.