DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and nas-2

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_503678.3 Gene:nas-2 / 186345 WormBaseID:WBGene00003521 Length:272 Species:Caenorhabditis elegans


Alignment Length:216 Identity:61/216 - (28%)
Similarity:96/216 - (44%) Gaps:43/216 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GIFAPNLVASEGIESYE-NYYNEIHIDDEQAEAKTRNALTSPLQ----RWPGNKILYRISTDYSE 72
            ||...|::..  :.::| :.|..|:|    ...|.|.....|||    .||..::.|.|:|.|:.
 Worm    17 GISENNILTK--LPTFEPSKYGHINI----PLRKKRGIALHPLQWASYLWPNAEVPYDIATHYTS 75

  Fly    73 QEVANVRTAMSSFGEQTCVQFEEIEGAPPAG--KRYVSFKKSPNM--CGTRVGYQP--LSFGPHE 131
            .|.:.:.:||.:|...|||:|.     |.|.  |.|:...|..|:  |.:.:|.|.  ..||..|
 Worm    76 TEKSIILSAMEAFKNVTCVRFR-----PRAATDKHYLQINKYFNVERCFSYIGRQSSRTLFGTPE 135

  Fly   132 VVLNEKCLTMPA--------VIQHETLHLLGLFHEQSRPDRDEYV---QIDYD-NIPRKYWSQFM 184
            ..:..:....||        ::.||.:|:||.:||..|.|||..:   .:.|: .|.|:..:.:|
 Worm   136 GNVETRMRLDPACLRGNGRGIVMHELMHILGFYHEHQRDDRDRRIVGSAVHYNFKIYRRAKTLYM 200

  Fly   185 AMDQTTTFNVPYDYESVMHYS 205
            .         .||..|:|||:
 Worm   201 G---------AYDANSIMHYN 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 50/173 (29%)
ZnMc_astacin_like 59..249 CDD:239807 47/165 (28%)
nas-2NP_503678.3 Astacin 58..240 CDD:279708 49/169 (29%)
ZnMc 62..236 CDD:294052 47/165 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.