DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and nas-1

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_499768.2 Gene:nas-1 / 185811 WormBaseID:WBGene00003520 Length:270 Species:Caenorhabditis elegans


Alignment Length:245 Identity:65/245 - (26%)
Similarity:113/245 - (46%) Gaps:33/245 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LVASEGIESYENYYNEIHIDDEQAEAKTRNALTSPLQRWPGNKILYRISTDYSEQEVANVRTAMS 83
            |:.:.......:.|:::.|..::.:.....|:.:...:||..::.|.:|..|:..:.|.:..|..
 Worm    42 LLPTTNTRRVRSLYHDMRIPFQRFKRGGGVAVAAEKDKWPNGRVPYILSAAYTSAQRAVLARAFD 106

  Fly    84 SFGEQTCVQFEEIEGAP--PAGKRYVSFKKSPNMCG--TRVGYQPLSFGPHEVVLNEKCLTMPAV 144
            ::.::||::|     .|  ||.|.|:..:|......  :|||      |..:|.|.::|:....:
 Worm   107 TYAKRTCIRF-----VPKSPADKDYIVIQKLDGCYADFSRVG------GRQQVSLADECIDYATI 160

  Fly   145 IQHETLHLLGLFHEQSRPDRDEYVQIDYDNIPRKYWSQFMAMDQ--TTTFNVPYDYESVMHYSKN 207
            | ||.:|::|..||..|.|||.||.|.|.|:.:...:.|..:..  .:.:...|||.|:|||..|
 Worm   161 I-HELMHVIGFIHEHQREDRDSYVSILYQNVIQGANTDFDKLSNLGLSYYGEHYDYSSIMHYEAN 224

  Fly   208 AFAKDPSKPTIRA------LIGGKAVEREMGQVRGPSEGDWTKIRLMYKC 251
            ..::: .|.||.|      .|.|||.:.        |..|..::...|||
 Worm   225 EGSRN-GKNTIEAKNSHFTAIMGKASDF--------STSDLRRVNRAYKC 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 59/207 (29%)
ZnMc_astacin_like 59..249 CDD:239807 56/201 (28%)
nas-1NP_499768.2 Astacin 79..266 CDD:279708 61/208 (29%)
ZnMc_astacin_like 82..263 CDD:239807 56/201 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6774
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.