DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and nas-28

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_498342.3 Gene:nas-28 / 185658 WormBaseID:WBGene00003546 Length:497 Species:Caenorhabditis elegans


Alignment Length:250 Identity:81/250 - (32%)
Similarity:118/250 - (47%) Gaps:36/250 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SEGIESYENYYNEIHIDDEQAE-----------AKTRNALTSPLQRWPGN-KILYRISTDYSEQE 74
            ::.|..| .:.::|.::::||:           ...|.|:......|..: .|.|:..|..|...
 Worm    85 NQDINEY-TFESDIMLNEKQAKHIATAIENGNYRSKRQAIVDTTNFWSVSVPIFYQFDTKLSATN 148

  Fly    75 VANVRTAMSSFGEQTCVQFEEIEGAPPAGKRYVSFKKSPNMCGTRVG------YQPLSFGPHEVV 133
            :||||.|:..:.:.:|:.|:|...|     :...|..|...|.:.||      ||.:|.||:   
 Worm   149 IANVRKAIQFWNDNSCLSFKEDNNA-----KNRLFLSSAGGCWSYVGKQVDMPYQMVSVGPN--- 205

  Fly   134 LNEKCLTMPAVIQHETLHLLGLFHEQSRPDRDEYVQIDYDNI--PRKYWSQFMAMDQTTTFNVPY 196
                |.|. ....||.:|.:|.:|:|||.|||.||.:|:.||  .:.|..|.||:||....|:||
 Worm   206 ----CDTF-GTATHELMHAIGFWHQQSRADRDNYVYVDFSNIIPSQAYNFQKMAVDQAQLLNLPY 265

  Fly   197 DYESVMHYSKNAFAKDPSKPTIRALIGGKAVEREMGQVRGPSEGDWTKIRLMYKC 251
            ||.|||.|...|||.|.||.||.|...|  .:..|||...|:..|...:..:|.|
 Worm   266 DYGSVMQYYPYAFAVDSSKYTILAKENG--FQNSMGQREAPAFSDIIGVNKLYNC 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 73/204 (36%)
ZnMc_astacin_like 59..249 CDD:239807 71/198 (36%)
nas-28NP_498342.3 Astacin 135..320 CDD:279708 72/198 (36%)
ZnMc_astacin_like 135..316 CDD:239807 71/195 (36%)
CUB 393..480 CDD:214483
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6774
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14369
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.