DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and nas-14

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_502533.2 Gene:nas-14 / 184247 WormBaseID:WBGene00003533 Length:503 Species:Caenorhabditis elegans


Alignment Length:238 Identity:76/238 - (31%)
Similarity:111/238 - (46%) Gaps:50/238 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IDDEQAEAK----TRNALTSPLQRWPGNKILYRISTDYSEQEVANVRTAMSSFGEQTCVQFEEIE 97
            :|:::...|    ..|.:|.|.:.||..::.|.:....:..:...:..|...:..:|||:|    
 Worm   101 LDEDEIFRKPFHSALNLVTYPDKLWPEGQVPYMLEEGMTNDQRTAIAQAFDEYKTKTCVRF---- 161

  Fly    98 GAPPAG--------KRYVSFKKSPNMCGTRVGYQPLSFGPHEVVLNEKCLTMPAVIQHETLHLLG 154
             .|...        ||.|:|..| :..|...|.|.:|.   ||   :||.: ..:|.||.:|.||
 Worm   162 -VPKTDDDFDYIYVKRNVAFGCS-SYVGRAGGNQTVSL---EV---DKCFS-KGIIAHELMHALG 217

  Fly   155 LFHEQSRPDRDEYVQIDYDNI-----------PRKYWSQFMAMDQTTTFNVPYDYESVMHYSKNA 208
            .|||.||.|||::|.|:.|||           |||.         ..:..:||||||||||.|.|
 Worm   218 FFHEHSRTDRDDFVDINEDNIRPGMMRNFEKYPRKI---------IDSLGMPYDYESVMHYHKLA 273

  Fly   209 FAKDPSKPTIRALIGGKAVEREMGQVRGPSEGDWTKIRLMYKC 251
            |::: .||||..    |..|.::||....||.|..|:..:|:|
 Worm   274 FSRN-GKPTIIP----KDNEADVGQRYKLSEMDSKKVNKLYQC 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 70/214 (33%)
ZnMc_astacin_like 59..249 CDD:239807 67/208 (32%)
nas-14NP_502533.2 Astacin 123..313 CDD:279708 71/216 (33%)
ZnMc_astacin_like 128..309 CDD:239807 67/207 (32%)
ShKT 380..414 CDD:214586
ShK 468..503 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.