DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and nas-8

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_501114.2 Gene:nas-8 / 183207 WormBaseID:WBGene00003527 Length:403 Species:Caenorhabditis elegans


Alignment Length:234 Identity:68/234 - (29%)
Similarity:114/234 - (48%) Gaps:47/234 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IDDEQAEAKTRNALTSPLQRWPGNKILYRISTDYSEQEVANVRTAMSSFGEQTCVQF-------- 93
            :|.:.:|:..||.:.:..::||..:|.|.||..|:::|.|.:..:..::.::|||:|        
 Worm   101 LDPKNSESLRRNGVITGTRKWPNGRIPYVISNQYNDRERAVLARSFQAYHDKTCVRFVPRTAVDN 165

  Fly    94 -----EEIEGAPPAGKRYVSFKKSPNMCGTRVGYQPLSFGPHEVVLNEKCLTMPAVIQHETLHLL 153
                 .:|:|                 |.:.||   .:.|..|:.|:..||.....| ||.:|.:
 Worm   166 DYLYIGKIDG-----------------CYSDVG---RAGGRQELSLDNGCLQYDTAI-HELMHSV 209

  Fly   154 GLFHEQSRPDRDEYVQIDYDNIPRKYWSQFMAMD--QTTTFNVPYDYESVMHYSKNAFAKDPSKP 216
            |.:||..|.||||::.|.:.||.|:.:.||..:|  :::.:...|||.|:|||...||:|:..:.
 Worm   210 GFYHEHERWDRDEHITILWHNIDREAYDQFGKVDLAESSYYGQLYDYYSIMHYDSLAFSKNGFET 274

  Fly   217 TIRALIGGKAVEREMGQVRGP----SEGDWTKIRLMYKC 251
            .:       |.:.||..|.|.    |..|..|:.|||:|
 Worm   275 MV-------AKQSEMTAVIGAAIDFSPIDILKMNLMYQC 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 63/214 (29%)
ZnMc_astacin_like 59..249 CDD:239807 59/208 (28%)
nas-8NP_501114.2 Astacin 119..308 CDD:279708 64/216 (30%)
ZnMc_astacin_like 123..304 CDD:239807 59/208 (28%)
ShK 337..372 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.