Sequence 1: | NP_650414.1 | Gene: | CG6974 / 41815 | FlyBaseID: | FBgn0038285 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_501871.2 | Gene: | nas-12 / 182848 | WormBaseID: | WBGene00003531 | Length: | 384 | Species: | Caenorhabditis elegans |
Alignment Length: | 234 | Identity: | 61/234 - (26%) |
---|---|---|---|
Similarity: | 93/234 - (39%) | Gaps: | 60/234 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 IFAPNLVASEGIESYENYYNEIHIDDEQAEAKTRNALTSPLQRWPGNKILYRISTDYSEQEVANV 78
Fly 79 RTAMSSFGEQTCVQFEE------------IEGAPPAGKRYVSFKKSPNMCGTRVGYQPLSFGPHE 131
Fly 132 VVLNEKCLTMPAVIQHETLHLLGLFHEQSRPDRDEYVQIDYDN-IPRKYWSQFMAMDQTTTFNVP 195
Fly 196 ----YDYESVMHYSKNAFAK------------DPSKPTI 218 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6974 | NP_650414.1 | Astacin | 55..251 | CDD:279708 | 54/193 (28%) |
ZnMc_astacin_like | 59..249 | CDD:239807 | 52/189 (28%) | ||
nas-12 | NP_501871.2 | Astacin | 81..272 | CDD:279708 | 54/193 (28%) |
ZnMc_astacin_like | 85..267 | CDD:239807 | 52/189 (28%) | ||
ShK | 286..325 | CDD:279838 | |||
ShK | 347..384 | CDD:279838 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D472790at33208 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000240 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10127 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.920 |