DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and nas-12

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_501871.2 Gene:nas-12 / 182848 WormBaseID:WBGene00003531 Length:384 Species:Caenorhabditis elegans


Alignment Length:234 Identity:61/234 - (26%)
Similarity:93/234 - (39%) Gaps:60/234 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IFAPNLVASEGIESYENYYNEIHIDDEQAEAKTRNALTSPLQRWPGNKILYRISTDYSEQEVANV 78
            :|...|:....:..|||      ..|.....:..:...|.:.||..|.:.|.||..||..:...:
 Worm    46 VFGDMLLTPAQLIRYEN------SKDSDLSIRGVSIKGSSMNRWSNNIVPYVISPQYSPAQKQIL 104

  Fly    79 RTAMSSFGEQTCVQFEE------------IEGAPPAGKRYVSFKKSPNMCGTRVGYQPLSFGPHE 131
            .:::..|...:|.:|.|            ::|.    ..||         |...|.|.||     
 Worm   105 VSSLRYFERVSCFKFVERTTQNDYLFIVPLDGC----YSYV---------GKIGGRQTLS----- 151

  Fly   132 VVLNEKCLTMPAVIQHETLHLLGLFHEQSRPDRDEYVQIDYDN-IPRKYWSQFMAMDQTTTFNVP 195
              |...|:. ..:|.||.:|.:|..||..|||||.::::||.| ||    .|.:..|:..|.:|.
 Worm   152 --LAADCIA-DYIIWHEMMHAIGFEHEHQRPDRDSFIRVDYANVIP----GQMINFDKLKTSHVE 209

  Fly   196 ----YDYESVMHYSKNAFAK------------DPSKPTI 218
                ||::|:|||...||.:            .|.||.:
 Worm   210 YPDIYDFKSIMHYDGYAFGRVDTARRVRLATMTPLKPGV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 54/193 (28%)
ZnMc_astacin_like 59..249 CDD:239807 52/189 (28%)
nas-12NP_501871.2 Astacin 81..272 CDD:279708 54/193 (28%)
ZnMc_astacin_like 85..267 CDD:239807 52/189 (28%)
ShK 286..325 CDD:279838
ShK 347..384 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.