DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and nas-6

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001040902.1 Gene:nas-6 / 181796 WormBaseID:WBGene00003525 Length:344 Species:Caenorhabditis elegans


Alignment Length:213 Identity:69/213 - (32%)
Similarity:104/213 - (48%) Gaps:28/213 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 NALTSPLQRWPGNKILYRISTDYSEQEVANVRTAMSSFGEQTCVQFEEIEGAPPAGKRYVSFKKS 112
            |||.:....|.|..|.|.:.|.:|..|:..:..|..|:...||::||:.||...    |::..|.
 Worm    72 NALKNKQLTWEGGVIPYEMDTAFSPNEIKILEKAFDSYRRTTCIRFEKREGQTD----YLNIVKG 132

  Fly   113 PNMCGTRVGYQPLSFGPHEVVLNEKCLTMPAVIQHETLHLLGLFHEQSRPDRDEYVQIDYDNIPR 177
            .. |.::||   .:.|..|:.|...|. ...:|.||.:|.:|.:||.||.|||::::|::|||..
 Worm   133 YG-CYSQVG---RTGGKQEISLGRGCF-FHEIIVHELMHSVGFWHEHSRADRDDHIKINWDNILP 192

  Fly   178 KYWSQFMAMDQTTTF-----NVPYDYESVMHYSKNAFAKDPSKPTIRALIGGKAVEREMGQVRGP 237
            ...|||   |:.:..     ...|||:|:|||...||::: .:.||      :.||....||.|.
 Worm   193 GMKSQF---DKISAVLQDLQGENYDYKSIMHYDSTAFSRN-GRNTI------ETVENGFTQVIGT 247

  Fly   238 ----SEGDWTKIRLMYKC 251
                |..|..||..:|.|
 Worm   248 AMDLSPLDIVKINKLYSC 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 65/204 (32%)
ZnMc_astacin_like 59..249 CDD:239807 63/198 (32%)
nas-6NP_001040902.1 Astacin 80..265 CDD:279708 65/203 (32%)
ZnMc_astacin_like 83..263 CDD:239807 63/198 (32%)
ShK 299..334 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.