Sequence 1: | NP_650414.1 | Gene: | CG6974 / 41815 | FlyBaseID: | FBgn0038285 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_741532.1 | Gene: | nas-9 / 178875 | WormBaseID: | WBGene00003528 | Length: | 546 | Species: | Caenorhabditis elegans |
Alignment Length: | 203 | Identity: | 61/203 - (30%) |
---|---|---|---|
Similarity: | 103/203 - (50%) | Gaps: | 10/203 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 52 SPLQRWP-GNKILYRISTDYSEQEVANVRTAMSSFGEQTCVQFEEIEGAPPAGKRYVSFKK--SP 113
Fly 114 NMCGTRVGYQPLSFGPHEVVLNEKCLTMPAVIQHETLHLLGLFHEQSRPDRDEYVQIDYDNIPRK 178
Fly 179 YWSQFMAMDQT--TTFNVPYDYESVMHYSKNAFAKDPSKPTIRALIGGKAVEREMGQVRGPSEGD 241
Fly 242 WTKIRLMY 249 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6974 | NP_650414.1 | Astacin | 55..251 | CDD:279708 | 60/200 (30%) |
ZnMc_astacin_like | 59..249 | CDD:239807 | 56/193 (29%) | ||
nas-9 | NP_741532.1 | Astacin | 311..505 | CDD:279708 | 58/198 (29%) |
ZnMc_astacin_like | 316..505 | CDD:239807 | 56/193 (29%) | ||
ShKT | 510..546 | CDD:214586 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10127 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |