DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and nas-9

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_741532.1 Gene:nas-9 / 178875 WormBaseID:WBGene00003528 Length:546 Species:Caenorhabditis elegans


Alignment Length:203 Identity:61/203 - (30%)
Similarity:103/203 - (50%) Gaps:10/203 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SPLQRWP-GNKILYRISTDYSEQEVANVRTAMSSFGEQTCVQFEEIEGAPPAGKRYVSFKK--SP 113
            |.:|:|. ...|.|.:.....|.:..::|.|:......||:.|.  ..|.|.| .::::.|  |.
 Worm   308 SAVQKWDIWKPIQYTLDDSLEESDKKDIRDALHEISINTCILFR--YNATPKG-YHLNYMKVDST 369

  Fly   114 NMCGTRVGYQPLSFGPHEVVLNEKCLTMPAVIQHETLHLLGLFHEQSRPDRDEYVQIDYDNIPRK 178
            ..||  :.|...:...:.:.|:.:|.....|..|||:|.||:.|:..|.|||:|::||:.||..:
 Worm   370 TFCG--LSYVGRTDPANPIYLSFQCGDNRGVAMHETMHALGVSHQHLRLDRDKYIKIDWSNIDPQ 432

  Fly   179 YWSQFMAMDQT--TTFNVPYDYESVMHYSKNAFAKDPSKPTIRALIGGKAVEREMGQVRGPSEGD 241
            ::..|...|..  |::...|.|:|:|||:....||||:|||:..|:..:....::||....:.||
 Worm   433 HYDTFAISDAKLYTSYGTKYAYDSIMHYNAYLGAKDPNKPTMIPLVNPQENTPKLGQRAKLTRGD 497

  Fly   242 WTKIRLMY 249
            ...::.||
 Worm   498 IRLLKKMY 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 60/200 (30%)
ZnMc_astacin_like 59..249 CDD:239807 56/193 (29%)
nas-9NP_741532.1 Astacin 311..505 CDD:279708 58/198 (29%)
ZnMc_astacin_like 316..505 CDD:239807 56/193 (29%)
ShKT 510..546 CDD:214586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.