DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and nas-32

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_503351.3 Gene:nas-32 / 178595 WormBaseID:WBGene00003550 Length:653 Species:Caenorhabditis elegans


Alignment Length:208 Identity:65/208 - (31%)
Similarity:89/208 - (42%) Gaps:24/208 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NEI-HIDDEQAEAKTR--NALTSPLQRWPGNKILYRISTDYSEQEVANVRTAMSSFGEQTCVQFE 94
            |:| .|..||:....|  ..:.:..|.|||..:.|...:..:......||.|::.....||::||
 Worm   185 NQIAKISSEQSSKSRRKKRQIDNLAQFWPGKVVYYYFDSGLTTTVQQIVRDAITFLESNTCLKFE 249

  Fly    95 EIEGAPPAGKRY--VSFKKSPNMCGTRVGYQPLSFGPHEVVLNEKCLTMPAVIQHETLHLLGLFH 157
            ....|....|.:  |.......|.|   |.|.||.|       ..| .:.....||..|.|||||
 Worm   250 LNSTATNRVKIFSGVGCYSDTGMLG---GEQTLSLG-------YGC-EVTGTAAHEIAHTLGLFH 303

  Fly   158 EQSRPDRDEYVQIDYDNIPRKYWSQFMAMDQTTTFN-VPYDYESVMHYSKNAFAKD-------PS 214
            .|.|.|||:||.||..::|......|:.:.:.|:.| |.|:|.|.||||..||...       |.
 Worm   304 TQMRSDRDDYVTIDLTDVPESSQQNFIKLTEATSTNLVDYEYGSFMHYSGRAFVSSGGVDSIVPK 368

  Fly   215 KPTIRALIGGKAV 227
            .|.:...:||:.|
 Worm   369 DPVMVYTMGGRIV 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 59/183 (32%)
ZnMc_astacin_like 59..249 CDD:239807 56/179 (31%)
nas-32NP_503351.3 Astacin 210..397 CDD:279708 59/183 (32%)
ZnMc_astacin_like 214..393 CDD:239807 56/179 (31%)
CUB 464..>528 CDD:294042
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14369
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.