DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and toh-1

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_497769.3 Gene:toh-1 / 175491 WormBaseID:WBGene00006591 Length:414 Species:Caenorhabditis elegans


Alignment Length:180 Identity:55/180 - (30%)
Similarity:86/180 - (47%) Gaps:26/180 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 NALTSPLQRWPGNKILYRISTDYSEQEVANVRTAMSSFGEQTCVQFEEIEGAPPAGKRYVSFKKS 112
            |:...|.|.|.|         ||:.|.:  :|..:..:.:.||::|:|.:.:..| .|||..|  
 Worm    72 NSYEIPFQIWGG---------DYNFQSL--IRRGIRMWEDSTCLRFKENQQSRDA-IRYVLEK-- 122

  Fly   113 PNMCGTRVGYQPLSFGPHEVVLNEKCLTMPAVIQHETLHLLGLFHEQSRPDRDEYVQIDYDNIPR 177
            .:.|.|.  |...:.|..::::..:| ....|:.|||.|.||.:|...|||||.::.|::.|:..
 Worm   123 GDSCFTE--YIGRNGGHQDIIIGSEC-AEEYVVAHETGHALGFWHTHQRPDRDRHISINWKNVME 184

  Fly   178 KYWSQFM---------AMDQTTTFNVPYDYESVMHYSKNAFAKDPSKPTI 218
            :..:.||         .:.|.:...|||||.|:|||...|.|...|..||
 Worm   185 EATASFMPFRSMLQAFGIRQVSPRRVPYDYGSLMHYHAVAHAVKVSDFTI 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 53/173 (31%)
ZnMc_astacin_like 59..249 CDD:239807 51/169 (30%)
toh-1NP_497769.3 Astacin 71..265 CDD:279708 55/180 (31%)
ZnMc_astacin_like 73..262 CDD:239807 54/179 (30%)
CUB 320..410 CDD:214483
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_111101
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.