DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and nas-25

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_495880.1 Gene:nas-25 / 174412 WormBaseID:WBGene00003544 Length:399 Species:Caenorhabditis elegans


Alignment Length:210 Identity:63/210 - (30%)
Similarity:96/210 - (45%) Gaps:14/210 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KTRNALTSPLQRWPGNKILYRISTDYSEQEVANVRTAMSSFGEQTCVQFEEIEGAPPAGK--RYV 107
            |.|........|||.|.:.|.:....|..: .:||.|:......||::|:.:......|.  |.|
 Worm    38 KVRQVQRDLTYRWPNNTVPYYVGNVTSTIK-KSVRLAIEELQAWTCIRFQNVNEKYSDGDSVRIV 101

  Fly   108 SFKKSPNMCGTRVGYQPLSFGPHEVVLNEKCLTMPAVIQHETLHLLGLFHEQSRPDRDEYVQIDY 172
            ..    ..|.:.:|.|.:  |..:|.|.:.|..|...| ||.:|.:|:.|.|||.||:.|:.|..
 Worm   102 DL----GSCSSPIGRQQI--GTQDVSLTKNCWGMGTAI-HELMHAIGIEHTQSRSDRNRYLDILA 159

  Fly   173 DNIPRKYWSQFMAMDQTTTFN-VPYDYESVMHYSKNAFAKDPSKPTIRALIGGKAVEREMGQVRG 236
            .||..:....|..:......| |||||.||||||.::|:....:.|:  |...::....||.:. 
 Worm   160 QNIDNRDLPNFELLSPRLWANLVPYDYGSVMHYSADSFSNKDDEQTM--LPKDRSFIETMGSMI- 221

  Fly   237 PSEGDWTKIRLMYKC 251
            |:..|:.:|...|:|
 Worm   222 PNFYDFDQINQYYQC 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 60/198 (30%)
ZnMc_astacin_like 59..249 CDD:239807 56/192 (29%)
nas-25NP_495880.1 Astacin 48..236 CDD:279708 60/198 (30%)
ZnMc_astacin_like 52..234 CDD:239807 56/192 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.