DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and Mep1b

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_032612.2 Gene:Mep1b / 17288 MGIID:96964 Length:704 Species:Mus musculus


Alignment Length:270 Identity:85/270 - (31%)
Similarity:129/270 - (47%) Gaps:42/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FLKAVRYLLLAGIFAPNLVASE----------------GIESYENYYNEIHIDDEQAEAKTRNAL 50
            ||....:||::|:.||.....:                |::.:|.        |.:.||..:|::
Mouse     9 FLVFATFLLVSGLPAPEKFVKDIDGGIDQDIFDINQGLGLDLFEG--------DIKLEANGKNSI 65

  Fly    51 TSPLQRWPGNKILYRISTDYSEQEVANVRTAMSSFGEQTCVQFEEIEGAPPAGK-RYVS-FKKSP 113
            ....:||| :.|.|.:...........:..|...:..:||:.|:     |.:|: .|:| ||.|.
Mouse    66 IGDHKRWP-HTIPYVLEDSLEMNAKGVILNAFERYRLKTCIDFK-----PWSGEANYISVFKGSG 124

  Fly   114 NMCGTRVGYQPLSFGPHEVVLNEKCLTMPAVIQHETLHLLGLFHEQSRPDRDEYVQIDYDNI-PR 177
              |.:.||  .:..|..|:.:...|..: |.:|||.||.||.:|||||.|||:||.|.:|.| |.
Mouse   125 --CWSSVG--NIHAGKQELSIGTNCDRI-ATVQHEFLHALGFWHEQSRADRDDYVIIVWDRIQPG 184

  Fly   178 KYWSQFMAMDQTT-TFNVPYDYESVMHYSKNAFAKDPSKPTIRALIGGKAVEREMGQVRGPSEGD 241
            |..:..:..|..: :.||||||.|||||||.|| ::.::.||...|  ...|..:||....|:.|
Mouse   185 KEHNFNIYNDSVSDSLNVPYDYTSVMHYSKTAF-QNGTESTIVTRI--SEFEDVIGQRMDFSDYD 246

  Fly   242 WTKIRLMYKC 251
            ..|:..:|.|
Mouse   247 LLKLNQLYNC 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 71/199 (36%)
ZnMc_astacin_like 59..249 CDD:239807 67/193 (35%)
Mep1bNP_032612.2 ZnMc 30..256 CDD:294052 77/247 (31%)
Astacin 70..258 CDD:279708 72/201 (36%)
MAM 266..430 CDD:279023
MAM 266..428 CDD:99706
MATH 428..587 CDD:295307
EGF_CA 609..647 CDD:238011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.