DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and Mep1a

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_032611.2 Gene:Mep1a / 17287 MGIID:96963 Length:760 Species:Mus musculus


Alignment Length:242 Identity:82/242 - (33%)
Similarity:113/242 - (46%) Gaps:29/242 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IFAPNLVASEGIESYENYYNEIHIDDEQAEAKTRNALTSPLQRW--PGNKILYRISTDYSEQEVA 76
            ||..||.|  |:..::   .:|.:      .:||||:..|..||  |   |.|.::.:.......
Mouse    55 IFEINLAA--GLNLFQ---GDILL------PRTRNAMRDPSSRWKLP---IPYILADNLELNAKG 105

  Fly    77 NVRTAMSSFGEQTCVQFEEIEGAPPAGKRYVSFKKSPNMCGTRVGYQPLSFGPHEVVLNEKCLTM 141
            .:..|...|..::||.|:..||.    ..|:.|:|... |.:.:|.|.:.   ..:.:.|.| ..
Mouse   106 AILHAFEMFRLKSCVDFKPYEGE----SSYIIFQKLSG-CWSMIGDQQVG---QNISIGEGC-DF 161

  Fly   142 PAVIQHETLHLLGLFHEQSRPDRDEYVQIDYDNIPRKYWSQFMAMDQT--TTFNVPYDYESVMHY 204
            .|.|:||.||.||.||||||.|||:||.|.:|.|...|...|...|..  |..|.||||||:|||
Mouse   162 KATIEHEILHALGFFHEQSRTDRDDYVNIWWDQIITDYEHNFNTYDDNTITDLNTPYDYESLMHY 226

  Fly   205 SKNAFAKDPSKPTIRALIGGKAVEREMGQVRGPSEGDWTKIRLMYKC 251
            ...:|.|:.|.|||...|  ......:||:...|..|..::..||.|
Mouse   227 GPFSFNKNESIPTITTKI--PEFNTIIGQLPDFSAIDLIRLNRMYNC 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 69/199 (35%)
ZnMc_astacin_like 59..249 CDD:239807 64/191 (34%)
Mep1aNP_032611.2 ZnMc 46..271 CDD:381785 81/240 (34%)
MAM 281..444 CDD:366209
MATH 443..607 CDD:351761
EGF 688..722 CDD:333761
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6774
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.