DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and nas-36

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_492109.2 Gene:nas-36 / 172506 WormBaseID:WBGene00003552 Length:617 Species:Caenorhabditis elegans


Alignment Length:186 Identity:59/186 - (31%)
Similarity:87/186 - (46%) Gaps:14/186 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IDDEQAEAKTRNALTSPLQRWPGNKILYRISTDYSEQEVANVRTAMSSFGEQTCVQFEEIEGAPP 101
            :..::.:...|:.::.....|....|.||.........::.:..|:..:.:.||:.||.:..:|.
 Worm   116 LSKDKTKRLRRSFVSDKTATWKTMPIKYRFHESIDFYTISQIIAAIRFWEDSTCITFENVSDSPD 180

  Fly   102 AGKRYVSFKKSP---NMCGTRVGYQPLSFGPHEVVLNEKCLTMPAVIQHETLHLLGLFHEQSRPD 163
            ..  |:.|....   :|.|...|.|.:|.|       |.|:.| .||:||..|.|||:|||||||
 Worm   181 GD--YIEFFSGQGCYSMIGRNGGRQGISIG-------ESCVKM-GVIEHEIGHALGLWHEQSRPD 235

  Fly   164 RDEYVQIDYDNIPRKYWSQFMAM-DQTTTFNVPYDYESVMHYSKNAFAKDPSKPTI 218
            ...||.|:.|.|...|.|.|:.. |:..|..:|||..|||||...||:.|....|:
 Worm   236 ALGYVTIERDFILPSYISDFLQRDDEIDTLGIPYDLGSVMHYGSTAFSVDQKSKTV 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 58/168 (35%)
ZnMc_astacin_like 59..249 CDD:239807 57/164 (35%)
nas-36NP_492109.2 Astacin 134..323 CDD:279708 58/168 (35%)
ZnMc_astacin_like 140..320 CDD:239807 57/162 (35%)
CUB 380..478 CDD:214483
TSP1 510..556 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14369
orthoMCL 1 0.900 - - OOG6_111101
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6486
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.