DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and LOC105946018

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_031756313.1 Gene:LOC105946018 / 105946018 -ID:- Length:583 Species:Xenopus tropicalis


Alignment Length:249 Identity:77/249 - (30%)
Similarity:110/249 - (44%) Gaps:37/249 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IFAPNLVASEGIESYENYYNEI-HIDDEQAEAKTRNALTSPLQRWPGNK----ILYRISTDYSEQ 73
            :|:..|.|::|        |.: .:.::.|...:|:|:||....|....    :.|.:.:.||..
 Frog   124 VFSRILKANQG--------NGVPRVQEDIAVGVSRSAITSTECLWQKTNETVYVPYTLDSKYSNS 180

  Fly    74 EVANVRTAMSSFGEQTCVQF----EEIEGAPPAGKRYVSFKKSPNMCGTRVGYQPLSFGPHEVVL 134
            ||..:.:||..:...|||||    :|.:        ||:. .|.:.|.:.:|.|    |..:||.
 Frog   181 EVNTMTSAMEVYATLTCVQFVPYTDEDD--------YVNI-TSGDGCWSYMGRQ----GGAQVVS 232

  Fly   135 NEK--CLTMPAVIQHETLHLLGLFHEQSRPDRDEYVQIDYDNIPRKYWSQFMAMDQTTTFNVPYD 197
            .||  | |......||..|.||..||.||.|||.||.|.|..|.......|..|: |...|..||
 Frog   233 VEKGYC-TSEGTTMHELNHALGFVHEHSRSDRDNYVNIMYQYISPGDIVNFEIMN-TNNLNTIYD 295

  Fly   198 YESVMHYSKNAFAKDPSKPTIRALIGGKAVEREMGQVRGPSEGDWTKIRLMYKC 251
            |.|:|||...||:....|.||.|.:....:   :|.....:..|..||..:|:|
 Frog   296 YRSIMHYPAWAFSNTTGKNTIVAKLNPNII---IGAGSTMTSLDIIKINRLYEC 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 66/205 (32%)
ZnMc_astacin_like 59..249 CDD:239807 64/199 (32%)
LOC105946018XP_031756313.1 C2 92..>113 CDD:417471
ZnMc 164..346 CDD:412141 65/199 (33%)
CUB 349..458 CDD:395345
CUB 463..574 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.