DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and astl

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_031755136.1 Gene:astl / 101730245 XenbaseID:XB-GENE-5769376 Length:972 Species:Xenopus tropicalis


Alignment Length:224 Identity:58/224 - (25%)
Similarity:98/224 - (43%) Gaps:35/224 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 EAKTRNALTSPLQRWP---GNKIL-YRISTDYSEQEVANVRTAMSSFGEQTCVQFEEIEGAPPAG 103
            |.::....::...:||   |:.|: |.:|:.|...:...:..|.......||::|.|    ....
 Frog    62 EKRSIRTFSARFAKWPKINGSVIIPYTLSSSYESFDRNIILKAFRDLQASTCLRFVE----RTTE 122

  Fly   104 KRYVSFKKSPNMCGT--RVGYQPLSFGPHEVVLNEKCLTM---PAVIQHETLHLLGLFHEQSRPD 163
            :.|::.:.:.....:  |||      |...|.|..:||..   ..:..||.:|:.|.:||.||.|
 Frog   123 RDYIAIEPAIGCFSSVGRVG------GMQLVSLAFECLRTDKGKGIALHELMHVAGFWHEHSRAD 181

  Fly   164 RDEYVQIDYDNIPRKYWSQFMAMDQTTTFNVPYDYESVMHYSKNAFAK------DPSKPTIRALI 222
            ||:|:.|.:|.|...|...|... .||...|.|:.:|::||.::||:|      :|..|..:.  
 Frog   182 RDDYIWIIWDEILIGYEKNFCKY-ATTNMLVKYELQSILHYPRSAFSKSGQATINPKYPYSKI-- 243

  Fly   223 GGKAVEREMGQVRGPSEGDWTKIRLMYKC 251
                   |:||....|..|..::..:|.|
 Frog   244 -------EIGQREKLSASDILRVNKLYSC 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 56/210 (27%)
ZnMc_astacin_like 59..249 CDD:239807 53/201 (26%)
astlXP_031755136.1 ZnMc_astacin_like 84..263 CDD:239807 52/198 (26%)
MAM 817..971 CDD:99706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.