DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and astl2d.5

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_031756347.1 Gene:astl2d.5 / 100495579 XenbaseID:XB-GENE-22069752 Length:497 Species:Xenopus tropicalis


Alignment Length:253 Identity:71/253 - (28%)
Similarity:105/253 - (41%) Gaps:45/253 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IFAPNLVASEGIESYENYYNEI-HIDDEQAEAKTRNALTSPLQRWPGNK----ILYRISTDYSEQ 73
            :|:..|.|::|        |.: .:.::.|...:|:|:|.....|....    :.|.:...||..
 Frog    43 VFSRILKANQG--------NRVPRVQEDIAVGVSRSAITYTECLWQKTNGTVYVPYTLDDKYSNS 99

  Fly    74 EVANVRTAMSSFGEQTCVQF----EEIEGAPPAGKRYVSFKKSPNMCGTRVGYQPLSFGPHEVVL 134
            ||..:.:||..:...|||||    :|.:        ||:. .|.:.|.:.:|.|.   |...|.:
 Frog   100 EVNTMTSAMEVYATLTCVQFVPYTDEDD--------YVNI-TSGDGCWSYMGRQR---GAQVVSV 152

  Fly   135 NEKCLTMPAVIQHETLHLLGLFHEQSRPDRDEYVQIDYDNIPRKYWSQFMAMDQTTTFNVPYDYE 199
            .:...|......||..|.||..|||||.|||.||.|.|..|.....::|..| ::......|||.
 Frog   153 EKGYCTSEGTTMHELNHALGFVHEQSRSDRDNYVNIMYQYISPGDVAEFKKM-ESNNLGTTYDYR 216

  Fly   200 SVMHYSKNAFAKDP------SKPTIRALIGGKAVEREMGQVRGPSEGDWTKIRLMYKC 251
            |||||...||:...      :||....:||.......:         |..||..:|:|
 Frog   217 SVMHYPAWAFSNTTGQNTIVAKPNPNIIIGAGNTMTSL---------DIIKINRLYEC 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 61/209 (29%)
ZnMc_astacin_like 59..249 CDD:239807 59/203 (29%)
astl2d.5XP_031756347.1 ZnMc 83..265 CDD:412141 60/203 (30%)
CUB 268..377 CDD:395345
CUB 382..493 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.