DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and astl2g

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_002934115.1 Gene:astl2g / 100491886 XenbaseID:XB-GENE-22069768 Length:505 Species:Xenopus tropicalis


Alignment Length:286 Identity:82/286 - (28%)
Similarity:118/286 - (41%) Gaps:66/286 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLAGIFAPNLVASEGIESYENYYNEIHIDDEQAEAKTRNALT---------------------- 51
            |::|.:.  ..:....:|.|....|:|.:..|:|:.:.::..|                      
 Frog     8 LIVASLM--QCILGAPLEIYFEEANKIAVSQEEAKPEPKDVFTIISETNKGVKKLLHESDIVVSV 70

  Fly    52 --------SPLQRWPGN----KILYRISTDYSEQEVANVRTAMSSFGEQTCVQF-------EEIE 97
                    ....||..:    ::.|.||.::|..||:.:..||..|...|||.|       :.::
 Frog    71 DRNAMKCDGDTCRWKTSDGIVRVPYTISANFSATEVSVIVDAMQDFATLTCVNFVPRTVEPDYLQ 135

  Fly    98 GAPPAGKRYVSFKKSPNMCGTRVGYQPLSFGPHEVVLNEKCLTMPAVIQHETLHLLGLFHEQSRP 162
            ..|.:|            |.:.||   .:.|..||.||:........:|||..|.||.:|||||.
 Frog   136 IIPDSG------------CWSYVG---KTGGAQEVSLNQGGCVGKGTVQHELNHALGFYHEQSRS 185

  Fly   163 DRDEYVQIDYDNIPRKYWSQFMAMDQTTTFNV--PYDYESVMHYSKNAFAKDPSKPTIRALIGGK 225
            |||.||.|...||.......|   |:..|.|:  .|||.|||||.:|||||.|...||   :...
 Frog   186 DRDNYVNILTGNIIPASIGNF---DKYNTNNLGQEYDYSSVMHYGRNAFAKQPGLDTI---VPKP 244

  Fly   226 AVEREMGQVRGPSEGDWTKIRLMYKC 251
            .....:||..|.|..|.:||..:|:|
 Frog   245 NPNVPIGQRYGLSNLDISKINQLYQC 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 72/208 (35%)
ZnMc_astacin_like 59..249 CDD:239807 69/202 (34%)
astl2gXP_002934115.1 Astacin 83..272 CDD:279708 73/209 (35%)
ZnMc_hatching_enzyme 88..270 CDD:239810 70/202 (35%)
CUB 270..384 CDD:238001 1/1 (100%)
CUB 387..497 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.